HOG Organism Gene ID Name Annotation
aHOG3352 hbo HBOR23350 Hbor_23350 hypothetical protein
>23350|hp|hbo
MPKLTAENTNAFAHRIAGDSLVYDCPECEYGEVLVTELIESPDARCLDCGTRYRLFVERV
EK