HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0335COG0118Glutamine amidotransferaseimidazoleglycerol-phosphate synthase

HOG Organism Gene ID Name Annotation
cHOG0335 nrc1 VNG2087 hisH2 imidazoleglycerol-phosphate synthase
cHOG0335 hmu HMUK0716 Hmuk_0716 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit( EC:2.4.2.- )
cHOG0335 hma RRNAC2794 hisH imidazole glycerol phosphate synthase subunit HisH
cHOG0335 hwa HQ1384A hisH imidazole glycerol phosphate synthase subunit HisH
cHOG0335 hla HLAC0375 Hlac_375 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
cHOG0335 hbo HBOR27470 Hbor_27470 imidazole glycerol phosphate synthase subunit hisH( EC:2.4.2.- )
cHOG0335 hut HUTA1775 Huta_1775 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
cHOG0335 hvo HVO_0448 HVO_0448 hisH imidazole glycerol phosphate synthase glutamine amidotr
cHOG0335 nph NP0082A hisH imidazole glycerol phosphate synthase subunit HisH
cHOG0335 hhi 75 hisH1 imidazole glycerol phosphate synthase subunit HisH
MUSCLE (3.6) multiple sequence alignment


2087|gene|nrc1      MVPAAPAVLRKLRRSIGVRVTVRLLNQKGFFILFAETDHSGRLRVRCGGPPVETKKAFGV
1384|gene|hwa       -----------------------------------------------MNVIIQLVYVRNN
1775|gene|hut       ------------------------------------------------------------
12794|gene|hma      ------------------------------------------------------------
75|gene|hhi         ------------------------------------------------------------
82|gene|nph         ------------------------------------------------------------
375|gene|hla        ------------------------------------------------------------
27470|gene|hbo      ------------------------------------------------------------
448|gene|hvo        ------------------------------------------------------------
                                                                                

2087|gene|nrc1      GGERTAMDTTGTGQRGASIVVVDYGLGNLRSVTRGLERASADVSIVGDPGALDDADGIVL
1384|gene|hwa       FSNVCENFCVST-QTTADIILVDYGLGNLRSVTRGLERAGASVTLSTDPETLADADGIVL
1775|gene|hut       ----MSE------RDRADVVVVDYGLGNLRSVTRGLERAGGRVEVTDDPGALDRADGIVL
12794|gene|hma      ----MSVR-----QTTADVVVVDYGLGNLRSVTRGLERAGANVSLSEDPAEFDAADGIVL
75|gene|hhi         ----MSVR-----QTTADVVVVDYGLGNLRSVTRGLERAGAEVSLSEDPAEFDAADGIVL
82|gene|nph         ----MDTT-----DRTAEVVLVDYGLGNLRSVTRGLERAGAEVTLSADPDDFSAADGIVL
375|gene|hla        ----MSTFEPPA-ETLADVVLVDYGLGNLRSATRGLERAGASVEITDDPEAFADADGVVL
27470|gene|hbo      ----MSTTTPEKRETVASVVMVDYGLGNLRSARRGLERAGADVTVSDDPETFADADGIVL
448|gene|hvo        ----MSTTQPPE-ETLADVVMVDYGLGNLRSAMRGLERAGANVVISDDPADFDDADGIVL
                                    *.:::**********. ******.. * :  **  :  ***:**

2087|gene|nrc1      PGVGAFGDGMENAGPFRDALTDAADEGRPLFGICLGMQMLLSSSEEADHEGQGDARGLDL
1384|gene|hwa       PGVGAFSEGMENAGPFRNALAAAVDRSQPVFGICLGMQMLLTSSEEADHAGEGEVKGLDF
1775|gene|hut       PGVGAFSEGMDNAGPFRDALLDAAEDGRPLLGICLGMQMLLTTSEEAEHAGEGDVEGLDL
12794|gene|hma      PGVGAFSEGMDNAGPFREALVEQAEAGKPLFGICLGMQMLLTTSEEADHEGQGDAEGLDL
75|gene|hhi         PGVGAFSEGMDNAGPFREALVEQAEAGKPLFGICLGMQMLLTTSEEADHEGQGDAEGLDL
82|gene|nph         PGVGAFSEGMENAGPFREALVAAAADGQPLFGICLGMQMLLTSSEEAETVGQGDVRGLDL
375|gene|hla        PGVGAFREGMENAGPLREALTDHADAGRPLFGICLGMQMLLTSSEEADHEGEGEVTGLDL
27470|gene|hbo      PGVGAFSEGMENAGPFREALAEAADRGQPIFGICLGMQMLLTSSEEADHAGEGEVEGLDF
448|gene|hvo        PGVGAFSEGMENAGPFREPLAEAAADGTPVFGICLGMQMLLTSSEEADHAGEGEVEGLDF
                    ****** :**:****:*:.*   .  . *::**********::****:  *:*:. ***:

2087|gene|nrc1      IPGRNVRFTGTVKVPHMGWNELAVTRDHPLVGG-----------------VDGEYAYFVH
1384|gene|hwa       ISGRNRRFDGNQKVPHMGWNELSISRDHPLVDD-----------------VDGKYAYFVH
1775|gene|hut       IPGTNLRFDGDRKVPHMGWNELAVERDHPLLAG-----------------VDGEYAYFVH
12794|gene|hma      IPGKNVRFSRDQTVPHMGWNELDVTRDHPLVEGVDSVGSKTPRADGTGGSVDGEHAYFVH
75|gene|hhi         IPGKNVRFSRDQTVPHMGWNELDVTRDHPLVEG-----------------VDGEHAYFVH
82|gene|nph         VPGRNVRFDEGQKVPHMGWNELNVARDHPIVEG-----------------IDGEYAYFVH
375|gene|hla        VPGTNVRFDVDRKVPHMGWNELEVERDHPLVEG-----------------VDGEYAYFVH
27470|gene|hbo      VPGRNVRFDEGQKVPHMGWNELHVQRDHPLVDG-----------------VDGEYAYFVH
448|gene|hvo        IPGRNVRFDEGQKVPHMGWNELNVQRDHPLVEG-----------------VDGEYAYFVH
                    :.* * **    .********* : ****:: .                 :**::*****

2087|gene|nrc1      SYYAAPDDPGHVVAETDYGERFPAVVANDAGNVFGTQFHPEKSGATGLRILRNFVDYCAD
1384|gene|hwa       SYYADPDDSNAVVATADYAREFPAVVADESGSVFGTQFHPEKSGETGLQILKNFVEFCRT
1775|gene|hut       SYYAEPDDTAATAASTEYGERFASVVANEAGNVMGTQFHPEKSGETGLRILENFVAYCAD
12794|gene|hma      SYYAVPDDESATVATTDYGTDFASIVANDAGNVFGTQFHPEKSGETGLRILRNYVDYCLD
75|gene|hhi         SYYAVPDDENATVATTDYGADFASIVANDAGNVFGTQFHPEKSGETGLRILRNFVDYCLD
82|gene|nph         SYYAAPDDDAAVVATTDYSVEFPAIVANEAGNVFGTQFHPEKSGETGLQILQNFVDYCLE
375|gene|hla        SYYAEPDDPDAVVATADYGVDFPAVVANEAGNVFGTQFHPEKSGETGLRILRNFVEYCAE
27470|gene|hbo      SYYAVPDDDGAVVATTDYGVEFPAIVANEAGNVFGTQFHPEKSGETGLQILRNFVELCAD
448|gene|hvo        SYYADPDDEGAVVASTDYGVAFPAVVANEAGTVFGTQFHPEKSGETGLTILRNFVEFCAE
                    **** ***   ..* ::*.  *.::**:::*.*:********** *** ** *:*  *  

2087|gene|nrc1      Q
1384|gene|hwa       A
1775|gene|hut       Q
12794|gene|hma      H
75|gene|hhi         H
82|gene|nph         R
375|gene|hla        R
27470|gene|hbo      Q
448|gene|hvo        R