HOG Organism Gene ID Name Annotation
aHOG3347 hbo HBOR01620 Hbor_01620 hypothetical protein
>1620|hp|hbo
MYGCYRLSNMTPNVTAASDASRAEVMASVDSTPARSEFIIADISCDNAWLSMTVEEAPSL
RDWA