HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0334COG0149KOG1643arCOG01087Triosephosphate isomerasetriosephosphate isomerase

HOG Organism Gene ID Name Annotation
cHOG0334 nrc1 VNG1027 tpiA triosephosphate isomerase
cHOG0334 hmu HMUK2370 Hmuk_2370 triosephosphate isomerase( EC:5.3.1.1 )
cHOG0334 hma RRNAC0537 tpiA triosephosphate isomerase
cHOG0334 hwa HQ3360A tpiA triosephosphate isomerase
cHOG0334 hla HLAC0683 Hlac_683 triosephosphate isomerase
cHOG0334 hbo HBOR19250 Hbor_19250 triosephosphate isomerase( EC:5.3.1.1 )
cHOG0334 hut HUTA0358 Huta_0358 triosephosphate isomerase
cHOG0334 hvo HVO_1300 HVO_1300 tpiA triosephosphate isomerase
cHOG0334 nph NP2182A tpiA_1 triosephosphate isomerase
cHOG0334 hhi 1106 tpiA triosephosphate isomerase (TIM)
MUSCLE (3.6) multiple sequence alignment


2182|gene|nph       MFVVVNLKAYPCDPVAVAEAAADVADETGVRIAVAPQAADISRVAETGVETWAQHVDAVD
10537|gene|hma      MFVLVNLKAYPCDPVEVATAAADVSDDSGVRVAVAPQAAQISAVAETGVETWAQHVSAVE
1106|gene|hhi       MFVLVNLKAYPCDPVEVATAAADVSDDSGVRVAVAPQAAQIGPVAETGVETWAQHVSAVE
1027|gene|nrc1      MFVLVNLKAYPCDPVAIAEAAADVAETTPATIAVAPQPADIGRVADTGATTYAQHVSPTE
3360|gene|hwa       MFILINLKAYPCDPLEIANAARDVANDSGVRIAVSPQAADIARVSDTGVETWAQHVSANN
683|gene|hla        MFILVNLKAYPCDPIEVATAARDVAEASGARIAVSPQAADIARVADTGVETWAQHVSPNA
19250|gene|hbo      MFILVNLKAYPCDPLEVATAAHEVAEESGVRIAVAPQAADVRRVADTGVETWAQHVDPNG
358|gene|hut        MFVLVNLKTYPCDPVEVAKAAKDVSDESGVRIGVAAQDADIARVADTGVETWAQHVDSIE
                    **:::***:*****: :* ** :*:: : . :.*:.* *::  *::**. *:****..  

2182|gene|nph       HGSHTGSTLAEAAAEAGAEGTLLNHSEKRLRLADIDGGLRAAERVGLESIVCANNPRQIA
10537|gene|hma      HGSHTGSTLAEAAADAGAVGTLLNHSENRLKLADIDGALDAADRADLETIVCANNPAQIG
1106|gene|hhi       HGSHTGSTLAEAAADAGAVGTLLNHSENRLKLADIDGALDAADRADLETIVCANNPAQIG
1027|gene|nrc1      HGSHTGSVLAESVADNGAVGTLLNHSEHRRRLADIDGSVAAAERAGLDTVVCANNPAQVA
3360|gene|hwa       YGSYTGSTLAEAVANAGATGTLINHSERRLTLADIDTAVNAASRVDLDTCVCANNPAQIG
683|gene|hla        HGSHTGSTLAEAVADNGAEGTLINHSENRLKLADIDGSVHAAERTELETIVCANNPAQVG
19250|gene|hbo      YGSHTGSTLAEAVAEAGADGTLINHSEKRLKLADIDGSVQAAARAGLETCVCANNPAQIG
358|gene|hut        YGSNTGHTLAETVADAGAVGTLINHSENRLKLADIDGSVEAAERAGLETCVCANNPAQIG
                    :** ** .***:.*: ** ***:****.*  ***** .: ** *. *:: ****** *:.

2182|gene|nph       AAAALEPDAVAVEPPALIGTGTPVSQADPEVVTDSVEAADAV-GDVDVLCGAGISTGDDL
10537|gene|hma      AAAALDPDGVAVEPPELIGTGTPVSKADPDIVTGAVDAAARVNGDVDVLCGAGISTGEDL
1106|gene|hhi       AAAALDPDGVAVEPPELIGTGTPVSKADPDIVTGAVDAAARVNGDVDVLCGAGISTGEDL
1027|gene|nrc1      AAAALGPDAVAVEPPALIGTGTPVSQADPDIVSDAVAAAEAVDPSVDVYCGAGITTGEDV
3360|gene|hwa       AVTALSPDSVAVEPPALIGGDASVATADPDIVSNAVESTNSIDKTVDVYCGAGISAGDDV
683|gene|hla        AAAALGPDAVAVEPPELIGGDVSVSTADPGIVEDAVAAAEAVDPAVDVFCGAGVSTGDDV
19250|gene|hbo      AVAALGPDSVAVEPPELIGGDDSVATADPDIVRDAVEAAANVDESVEVFCGAGISSGDDV
358|gene|hut        AVTALGPDSVAVEPPELIGGDVSVATGDPDIVTDAVEAAEAVDEDVEVYCGAGISTGDDV
                    *.:** **.****** *** . .*: .** :* .:* ::  :   *:* ****:::*:*:

2182|gene|nph       EAAAELGAEGVLLASGVAKADAPKAALRDLVEPIAE
10537|gene|hma      VSASDLGASGVLLASGVAKADDPRAALEDLVEPLL-
1106|gene|hhi       VSASDLGASGVLLASGVAKADDPRAALEDLVEPLL-
1027|gene|nrc1      VSAGDLGASGVLLASGVAKADDPRAALADLVAPL--
3360|gene|hwa       IAARDLGASGILLASGVAKADNPRKALEDLVVPI--
683|gene|hla        VAAGDLGAAGVLLASGVAKADDPKAVLEDLVSGI--
19250|gene|hbo      DAAGDLGATGILLASGVAKADDPRAALEDLVEPL--
358|gene|hut        ESAGELGATGVLLASGVAKADDPRAALEDLVEPLA-
                     :* :*** *:********** *. .* ***  :