HOG Organism Gene ID Name Annotation
aHOG3329 hbo HBOR16050 Hbor_16050 uncharacterized conserved protein
>16050|hp|hbo
MCGRYSLFTPQEELAERFDATFETPPEPRYNCAPGQRLPVVTDDDPEAFRFLKWGLVPQW
ADDQSVGNTLINARAETVREKPSFRDAFERRRCLVPADGFYEWVSADNGKQPYRVAFEDD
RPFAMAGLWERWKPPQTQTGLGDFAGDGDATDAEPEILETFTVVTAEPNELVSDLHDRMS
VILAPDEEETWLHGDAADAESLLDTHPDTEMRAYPVSTRVNSPVNDDADIIEPVEV