HOG Organism Gene ID Name Annotation
aHOG3327 hbo HBOR23250 Hbor_23250 hypothetical protein
>23250|hp|hbo
MPLSEYTGQSPLGNEDATVVRVVPHRLWQPGQTRTEACTNCGEELVLSEEHLLVVLEERG
TRTRRYFSEESCIRAWLGEEKQD