HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0332COG1014 COG0674arCOG01606pyruvate ferredoxin oxidoreductase.subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0332 nrc1 VNG0474 porA pyruvate ferredoxin oxidoreductase.subunit alpha
cHOG0332 hmu HMUK3087 Hmuk_3087 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein( EC:1.2.7.3 )
cHOG0332 hma RRNAC0718 porA pyruvate ferredoxin oxidoreductase subunit alpha
cHOG0332 hwa HQ1536A korA oxoglutarate--ferredoxin oxidoreductase, alpha subunit
cHOG0332 hla HLAC0928 Hlac_928 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
cHOG0332 hla HLAC2183 Hlac_2183 hypothetical protein
cHOG0332 hbo HBOR23330 Hbor_23330 2-oxoacid:ferredoxin oxidoreductase, alpha subunit( EC:1.2.7.3 )
cHOG0332 hut HUTA0897 Huta_0897 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
cHOG0332 hvo HVO_0888 HVO_0888 porA 2-oxoglutarate ferredoxin oxidoreductase alpha subunit
cHOG0332 nph NP1232A korA oxoglutarate--ferredoxin oxidoreductase, alpha subunit
cHOG0332 hhi 1366 porA pyruvate ferredoxin oxidoreductase subunit alpha
MUSCLE (3.6) multiple sequence alignment


2183|hp|hla         ------------------------------------------------------------
897|gene|hut        MVNDLNWAIGGEAGDGIDSTGKIFARALSRAGRHVFTSKDFASRIRGGYTAYKVRTAVER
474|gene|nrc1       MHDDLNWAIGGEAGDGIASTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDQ
1232|gene|nph       MPEDLNWAVGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDR
10718|gene|hma      MPEDLNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDR
1366|gene|hhi       MPEDLNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDR
928|gene|hla        MAADFNWAVGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDK
1536|gene|hwa       MPADFNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTAVDP
23330|gene|hbo      MPADFNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTAVDP
                                                                                

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        VESVVDRLDILIALTERTIDENLDELQEGSVIIYDGEQTTMADVEVPDGMIGLEVPLNSL
474|gene|nrc1       VQSVVDRLDILIALTERTVDENLDELHADSIIIYDGDRTEFADFESPAEVTGLDIPLKDL
1232|gene|nph       VESVVDRLDILIALTQRTVDENLDELHEDSIIIYDGERSMMSDFEAPGEMTGLDVPLKAL
10718|gene|hma      VESVVDRLDILIALTERTIHENEDELHEDSVIIYDGERSTMQDVEVPGDATALEVPLKRL
1366|gene|hhi       VESVVDRLDILIALTERTIHENEDELHEDSVIIYDGERSTMQDVEVPGDATALEVPLKRL
928|gene|hla        VQSVVDRLDVLIALTPRTIEENLDELHEGSVIIYDGERTTMQDVEIPDEMIGIDVPLKRL
1536|gene|hwa       VQSVVDRLDVLIALTPRTIKENHDELHEGSVIIYDGERTTMENVEIPDGMVGLDVPLKRL
23330|gene|hbo      VQSVVDRLDVLIALTPRTIEENLDELHEGSVIIYDGERTTMENVEIPEGMIGLDVPLKRL
                                                                                

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        AEEAGGAIMRNVVALGAASEVADFPVEYLDEALVKRFGEKGEAIIANNREAARLGRDYVR
474|gene|nrc1       AEDAGGAIMRNIVALGAVCAVADFPIENLDESLEKRFSGKGEQIIENNKQAARLGAEYVA
1232|gene|nph       AEDAGGAIMRNIVALGAACEVADFNIEYLDESLEKRFGGKGEAIVDNNKEAARLGAEYVR
10718|gene|hma      AEDAGGAIMLNVVALGAACEVTGFPIENLDESLEKRFGDKGEAIVENNKEAARKGQHYVQ
1366|gene|hhi       AEDAGGAIMLNVVALGAACEVTGFPIENLDESLEKRFGDKGEAIVENNKEAARKGQHYVQ
928|gene|hla        AEEAGGAIMRNVVALGAACEVAEFPIENLDSALEKRFADKGQKLVDNNKEAARAGQSYVD
1536|gene|hwa       AEEAGGAIMRNVVALGAACAVADFPIENLDSALEKRFGSKGQSLVENNKEAARSGRDYVG
23330|gene|hbo      AEEAGGAIMRNVVALGAACEVAEFPIENLDSALEKRFGSKGQQLVDNNKEAARKGQDYVA
                                                                                

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        EET-DCSHEFALETTDEDYVLLNGDEAIGMAAIAAGCRFYAGYPITPATDVMEYLTGRIE
474|gene|nrc1       EEFEDVTLPYELETTDEDYVLLNGDEAIGMGAIAAGCRFYAGYPITPATDVMEYLTGRIE
1232|gene|nph       EEY-DLSTPYDLETTDNDYVLLNGDEAIGMGAIAGGCRFYAGYPITPATDVMEYLKGRVE
10718|gene|hma      EEY--GEFDYDMETTDEDYVLLNGDEAIGMGAIAAGCRFYSGYPITPATDVMEYMTGRVD
1366|gene|hhi       EEY--GEFDYDMETTDEDYVLLNGDEAIGMGAIAAGCRFYAGYPITPATDVMEYMTGRVD
928|gene|hla        EEY-DHEFDYDLETTDEDYVLLNGDEAIGMGAIAAGCRFYAGYPITPATDVMTYLTGRIE
1536|gene|hwa       SEY-HNEFDYSLETTDADYVLLNGDEAIGMGAIAAGCKFYAGYPITPATNVMEYLTGRIE
23330|gene|hbo      DEY-DHEFDYDLETTDEDYVLLNGDEAIGMGAIAAGCKFYAGYPITPATDVMEYLTGRIE
                                                                                

2183|hp|hla         ----------------------MRAEARSRQAS---------------------------
897|gene|hut        AFGGAVVQAEDELSAINMALGAARAGARAMTATSGPGIDLMNETFGLVATSETPLVIANV
474|gene|nrc1       QFGGHVVQAEDELAAINLALGAARAGARSMTATSGPGIDLMSETFGLVATSETPLVIANV
1232|gene|nph       NYGGVVVQAEDELSAINMALGAARAGARSMTATSGPGIDLMAETFGLVATSETPLVICNV
10718|gene|hma      QFGGKVVQAEDELSAINMALGAARAGARAMTATSGPGIDLMTETFGLVATSETPLVICDV
1366|gene|hhi       QFGGKVVQAEDELSAINMALGAARAGARAMTATSGPGIDLMTETFGLVATSETPLVICDV
928|gene|hla        RYGGHVVQAEDELSAINMALGAARGGARSMTATSGPGIDLMTETFGLIATSETPLVICNV
1536|gene|hwa       QFGGHVLQAEDELSAINIALGAARAGARAMTATSGPGIDLMTETFGLIGTSETPLVIADV
23330|gene|hbo      NFGGHVVQAEDELAAINLALGAARAGARSMTATSGPGIDLMTETFGLVATSETPLVIVDV
                                           *. **:  *:                           

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        MRSGPSTGMPTKQEQGDLNAMLYGGHGEIPRFVLAPTTIGECFDRTVEAFNLAEKYQIPV
474|gene|nrc1       MRSGPSTGMPTKQEQGDLNMMLKGGHGEIPRFVVAPTSVAECFHKTVEAFNLAEKYQLPV
1232|gene|nph       MRSGPSTGMPTKQEQGDLTAMLHGGHGEVPRFVLAPTNISECFHKTVEAFNLAEKYQLPV
10718|gene|hma      MRSGPSTGMPTKQEQGDLNMTLYGGHGEIPRFVVAPTTVSECFWKTVEAFNLAEKYQTPV
1366|gene|hhi       MRSGPSTGMPTKQEQGDLNMTLYGGHGEIPRFVVAPTTVSECFWKTVEAFNLAEKYQTPV
928|gene|hla        MRSGPSTGMPTKQEQGDLNGMLYGGHGEVPRFVLAPTTIAECFWKTVEAFNLAEKYQLPV
1536|gene|hwa       MRSGPSTGMPTKQEQGDLNMLLYGGHGEIPRFVVAPTTIAECFWKTVEAFNLAEKYQTPV
23330|gene|hbo      MRSGPSTGMPTKQEQGDLNMLLYGGHGEIPRFVLAPTTIAECFWKTVEAFNLAEKYQTPV
                                                                                

2183|hp|hla         -----------------------------------DALAAWGQTKGLFEPHASGET----
897|gene|hut        YLTADLALAVTEQTYSPERFDMEGVEIDRGKVVDADEVGEWLDEKGRFKAHAATEDGVSP
474|gene|nrc1       YVTADLSMAVTERTYPPEEFDMDAVEIERGKLVDEDEISAWQNDTEQFRPHADTADGISP
1232|gene|nph       YLTADLSLAVTEQTFEPEEFDMDAVEIDRGKVVDEDNIDEWTNQKGQFQPHAITDDGISP
10718|gene|hma      FLVSDLAMAVTEQTFSPETFDMDEVEIDRGKVVDENEIDAWLDEKGRFQAHFAAADGVSP
1366|gene|hhi       FLVSDLAMAVTEQTFSPETFDMDEVEIDRGKVVDENEIDAWLDEKGRFQAHFAAADGVSP
928|gene|hla        YLTADLSMAVTEQTFTPDTFDMDEVEIDRGFVVDETTIDDHMSESGGFQPHEITDDGISP
1536|gene|hwa       YLAADLAMAVTERTFSPETFDMDDVEIERGKVVDESTIDQWQNEKSQFQPHALTDDGISP
23330|gene|hbo      YLTADLAMAVTEQTFSPEMFDMDKVEIDRGKVVDEDTISEWQNEKGQFQPHAITEDGISP
                                                         :  . . .  * .*         

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        RALPGTPDAAHMTTGLEHDELGRRTEEEDVRVEQVQKRQRKVDTARDREAFDYREFGDSD
474|gene|nrc1       RAVPGTEGGVHMSTGLEHDELGRRTEDTDVRVDQVDKRYRKVDTAREREQFDYREFGDSD
1232|gene|nph       RAFPGTEDGAHMSTGLEHDELGRRTEDTEMRVKQVDKRDRKVETAIEREDFDYREYGDAD
10718|gene|hma      RAFPGTTDGAHMTTGLEHDELGRRTEDTDVRIEQVDKRQRKVETAREQEDFDYREFGDSD
1366|gene|hhi       RAFPGTTDGAHMTTGLEHDELGRRTEDTDVRIEQVDKRQRKVETAREQEDFDYREFGDSD
928|gene|hla        RAFPGTADGAHMSTGLEHDEQGRRTEDTGMRVEQVDKRNRKVDTAEEREDWSPREFGDAD
1536|gene|hwa       RAFPGTTGGAHMSTGLEHDELGRRTEDTDMRVEQVDKRTRKVETARREEDLTPRSFGSED
23330|gene|hbo      RAFPGTDEGAHMSTGLEHDELGRRTEDTDMRIEQVDKRTRKVETAKAEEDWSPREFGNPD
                                                                                

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        AETLVISWGSNEGAMREALGMLD-DRGIDVRFLSVPYIYPRPDLTDEVEAAEDVIVVECN
474|gene|nrc1       ADNLVVSWGSNEGTIVEALEYLDGDDDPDIRVVSVPYIYPRPDLTDEVEAADDVVVVEAN
1232|gene|nph       ADTLVISWGSNEGAMREAIGYLD-EEDLDVRFISVPYIFPRPDLSEEIDAADDVIVVECN
10718|gene|hma      ADTLVISWGSNEGALREGLTLLE-EDGYDVRFLSVPYIFPRPDLSEEIEAAEDVIVVECN
1366|gene|hhi       ADTLVISWGSNEGALREGLTLLE-EDDYDVRFLSVPYIFPRPDLSEEIEAAEDVIVVECN
928|gene|hla        ADTLVISWGSNEGALAEAVDLLA-DEGVDVRVLSVPYIFPRPDLSEDVEAAENVIVVECN
1536|gene|hwa       APNLVISWGSNEGAMVEAMSILD-ERGIDVHFLSVPYLFPRYNLTEAIDEAETVIAVECN
23330|gene|hbo      ADTLVVSWGSNEGAMIEAIDFLE-EDGIDVRFLSIPYMFPRYDLTEAFEEADEVIVVECN
                                                                                

2183|hp|hla         ------------------------------------------------------------
897|gene|hut        ATGQFADLIEHDTLSRVQRVTKYTGVRFKADELADEIEGAIAGERAPQEVKR--------
474|gene|nrc1       ATGQFADVIEHDVLERVTRINNYTGVDFKADELAAEITESLA------------------
1232|gene|nph       ATGQFADLIEHDALTRVERINKYNGVRFKADELAEDIKAALGETAEVEA-----------
10718|gene|hma      ATGQFADVIEHDVLERVQRINKYNGVRFKADELATEIKQTLDTPPEATQ-----------
1366|gene|hhi       ATGQFADVIEHDVLERVQRINKYNGVRFKADELATEIKQTLDTPPEATQ-----------
928|gene|hla        ERGQFANLIEHDVLARVDRINKYNGVRFKADELADDIKETLAAGVEA-------------
1536|gene|hwa       ATGQFANVIEHDALSRVNRVNKYDGVRFKADELASKIEQTIDTASSAGTNEETETTEITQ
23330|gene|hbo      ATGQFADIIEHDTLTRVKRVNKYNGVRFKADELAADIKETLEA-----------------