HOG Organism Gene ID Name Annotation
aHOG3318 hbo HBOR16180 Hbor_16180 hypothetical protein
>16180|hp|hbo
MPSDEMSAYMETRRTVLRALPASVLALLGGCLGSPPHGTGPRRPPDAPAGQSRQTPEKPD
LYVKTFDFDETENGNLRVFGDVGNRGDVERVATVQVRVTRNGKEYTQETTVTVASGTTAS
FSVTFGISQETFLNGGSLNVDLV