HOG Organism Gene ID Name Annotation
aHOG3313 hbo HBOR21620 Hbor_21620 hypothetical protein
>21620|hp|hbo
MTHFPDAPILATALIVVQTGILIIGGLITYFSYKAYRRTGESSLYALTLGFGIITFGAII
AGALDIVLNVNLVKGVLVDSVLTLIGFAIIMYSLYVE