HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0033arCOG04664hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0033 nrc1 VNG1026 vng1026 no entry
tucHOG0033 hmu HMUK3404b Hmuk_3404 conserved hypothetical protein
tucHOG0033 hma RRNAC1666 hypothetical protein
tucHOG0033 hwa HQ3126A hypothetical protein
tucHOG0033 hla HLAC1790 Hlac_1790 membrane-bound metal-dependent hydrolase
tucHOG0033 hbo HBOR04900 Hbor_04900 Predicted membrane-bound metal-dependent hydrolase (DUF457)
tucHOG0033 hbo HBOR06360 Hbor_06360 hypothetical protein
tucHOG0033 hbo HBOR06370 Hbor_06370 hypothetical protein
tucHOG0033 hut HUTA0118 Huta_0118 membrane-bound metal-dependent hydrolase
tucHOG0033 hvo HVO_1883 HVO_1883 conserved hypothetical protein
tucHOG0033 nph NP1862A hypothetical protein
tucHOG0033 hhi 2206 HAH_2206 membrane-bound metal-dependent hydrolase
MUSCLE (3.6) multiple sequence alignment


6370|hp|hbo        MMAPTHVAAGIA-LAVPIAFLVPELAPLVVAAAVAGSVFPDFDMVAGEHRRTLHAVEAYA
4900|hp|hbo        ---MLAVVVAVV-FPESAAATTP---VPVLAAAALGGLFPDFDLYAG-HRKTLHFPVYFS
1026|hp|nrc1       MMVLTHIAVGFL-LAAPVAAAQPALGVPAAAGALVGGGAPDIDLLVGTHRRTLHYPVLGW
3126|hp|hwa        MMVTTHVAAGLL-LAVSVATFAPDFAIPAAIGAIIGGILPDIDFFIGAHRRTLHFPVYYT
6360|hp|hbo        MMVTTHAAAALLFFATPVALFAPEFTAAAIIGALLGGIVPDVDLFVGTHRKSLHFPVYAS
11666|hp|hma       MMLPTHAIAGLA-IATPLLVLAPDHAAVALAGGLVGGVLPDLDLYSG-HRRTLHYPSGYT
2206|gene|hhi      -MLPTHAIAGLA-IATPLLVLAPDHAAVALAGGLVGGVLPDLDLYSG-HRRTLHYPSGYT
118|gene|hut       MMLPTHALAGMA-LALPVAYVAPEFGGLALLAGLVGGMFPDFDMYVG-HRKTLHYPVYYA
1862|hp|nph        MMLPTHVLSGMA-LALPLLVVAPEFAPVGLVAGFLGGLAPDLDMYFG-HRKTLHYPVYYS
1790|gene|hla      MMLPTHVLGGML-LAAPLVRVAPELAPIGFVAGFLGGLFPDLDMYVG-HRKTLHFPVYYS
                            ..  :. .     *        ..  *.  **.*:  * **.:**      

6370|hp|hbo        VLTALVTFAAIVAPSPPVIAAAVFFAAAAVHPLLDLAGGSSEARPWEAATDRGVYLRSRE
4900|hp|hbo        GLAVPALVAAALSPSTLTLSVALFLAAAALHSVMDAFGGGLELKPWLGTSDRAVYSHYHN
1026|hp|nrc1       VGAVPAAVIAAVTPTALTVFVGVGAAAAAVHSTSDVLGAGDELRPWERTTTAAVYDHHAG
3126|hp|hwa        VAGGSVGLITIMTPSSLTVGITVGLLTAGIHSLSDWFGAGEELRPWERTSQRAVYIHPRQ
6360|hp|hbo        LAGVGAGIVALVAPSTASVAAAAFLLGAGLHAASDWFGGSDELRPWERTSRRAVYLHPRR
11666|hp|hma       LAVVPAAGFAAILQTPLLIALTFVLMGAALHCRMDRYGGGLELRPWEATSERAVYDHVRG
2206|gene|hhi      LAALPTAGFAAILQTPLLVALTFVLLGAALHCRMDRYGGGLELRPWEGTSERAVYDHVRG
118|gene|hut       ALAAPFVAIALFLPSVPTVIAAVFLVGAALHSLTDVFGGGLELRPWEGNSERAVYDHYRE
1862|hp|nph        VLAAVAVPVTLAAPSTVTIAMALFFLGAALHCVADVFGGGLELRPWEGTSERAVYDHLRG
1790|gene|hla      AFAALALFAALAVPSAATVGAALFLLGAAVHSVADMYGGGLELRPWEGNSDRAVYDHYRG
                            :    :   :        *.:*   *  *.. * .**   :  .** .   

6370|hp|hbo        SWVAPKRWVRYDGAPEDLALAAVLVTPGFVVFGTSVRIFAVGTLIVGLGYTFYRKRIPQL
4900|hp|hbo        RWIRPRRWIRYDGAPEDLFAAAMFAVPTLYAYDGTIQLGVYAALGISAVYVLVRKPMVVA
1026|hp|nrc1       RWWRARYVIPYDGSPADLAVAAAAAAPALVVYDGVVRWLLAALLALGAVYSLLRRRLVPY
3126|hp|hwa        QWLRPQYVIRYDGAPEDLALTFALAVPAALTFDGWLRAIVIIGIVIAGGYTITRKYIPRW
6360|hp|hbo        RWLRPRHIIRYDGAPEDFFLTVVLAIPVAYAVPS-VRLVVAAGLVVGAVYTLFRRRVPDV
11666|hp|hma       RWRPPKRWIQYDGAPADVGLMVLAGAPLFVVLDGPFRWVVAAALLTGATYGLLRRRLAAL
2206|gene|hhi      QWRSPKRWIQYDGAPSDVGLMVLVGSPLFVVLDGPFRWVVAAALVTGATYSLLRRRLATL
118|gene|hut       QWIAPRQWIGYDGSPGDLALSYGLAAPLLIAIEGPFQWVVIAALAVASVYSAVRRCLPRI
1862|hp|nph        EWIAPRRTVGYDGSPADLLLMGVFAVPLLAVLDGPLWLVVLGTALVGAVYTLTRRHLAAL
1790|gene|hla      TWIAPRQLVRYDGAVEDLALSIGLSLPLLYLLNGLFQQVVLGTLVVAAVYTMTRRHLAEL
                    *  ..  : ***:  *.        *        ..         .  *   *. :   

6370|hp|hbo        S----GRVNLPVPPVLTVVAALFSLFRR------------
4900|hp|hbo        A----QTVVDAMPE--HLVDRIPDRFVEDFR---------
1026|hp|nrc1       F----ERVV-------------------------------
3126|hp|hwa        L----EL---------------------------------
6360|hp|hbo        F----GV---------------------------------
11666|hp|hma       A----PVVFGNVPD--SIAAHVPDRYRQ------------
2206|gene|hhi      A----PVVFGNVPE--SISAHVPDRYRQ------------
118|gene|hut       AVTALDVATPWLPE--DVLSALPSRYRDGHPKSAGPSTSD
1862|hp|nph        A----PIVVRALPS--TVHPYVPARYRSEGRGQ-------
1790|gene|hla      A----AWITPYAPD--ALLPFLPDRYHDDDPKQ-------