HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0328COG1498KOG2574 KOG2572 KOG2573arCOG01923/2Protein implicated in ribosomal biogenesis Nop56p homologarchaeal nucleolar protein homolog

HOG Organism Gene ID Name Annotation
cHOG0328 nrc1 VNG1174 nop58 archaeal nucleolar protein homolog
cHOG0328 hmu HMUK2237 Hmuk_2237 Pre-mRNA processing ribonucleoprotein, binding domain protein
cHOG0328 hma RRNAC0864 nop56/58 nucleolar protein-like
cHOG0328 hwa HQ2568A nop56 pre-rRNA-processing protein nop56
cHOG0328 hla HLAC1041 Hlac_1041 Pre-mRNA processing ribonucleoprotein, binding domain protein
cHOG0328 hbo HBOR15430 Hbor_15430 rRNA biogenesis protein Nop56/Nop58
cHOG0328 hut HUTA0407 Huta_0407 Pre-mRNA processing ribonucleoprotein, binding domain protein
cHOG0328 hvo HVO_1670 HVO_1670 nop56/ archaeal nucleolar protein-like
cHOG0328 nph NP2064A nop56 pre-rRNA-processing protein nop56
cHOG0328 hhi 1502 HAH_1502 pre-mRNA processing ribonucleoprotein, binding domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2568|gene|hwa       MSKE----------------QSDNPAWFSDIDPDDIDAAATAITNGAAEDPQNWPTQAVE
1174|gene|nrc1      MTTH---------------------GWFADTAVRDADAAADAVRNGHADAPENWPAAAVE
15430|gene|hbo      MNDG---------------TAPTGTGWFEDIAPDDAESASEAIADGEADEPRDWPALAVE
1041|gene|hla       MTDT-----------------DDNAGWFAG----DESALRARIVDGEADEPRDWPGLAVE
2064|gene|nph       MTDE----------------RAVEDGWFADVPPGDVEAAAAAIRDGSAATVGEWPSLAVE
407|gene|hut        MDSGCFGSRVLFRRGGQRTTMNTEGAWFHDVSAGDDSTAQARIRDGEADDPADWPGLAVE
10864|gene|hma      MSNG----------------------WFAGLDPDDDAAAVEQIEAGRADTPEDWPQQAVE
1502|gene|hhi       MSNG----------------------WFAGLDPDDDAAAVEQIEAGRADTPEDWPQQAVE
                    *                         ** .    *  :    :  * *    :**  ***

2568|gene|hwa       SEIVEDTTTYYQLLHDAAITATQNAVESYEASDDRQLRHCLTAMDDVERTANELTERLTE
1174|gene|nrc1      DGVVDDADEYYDRLRDATRAATRAAVRERERADDQQLVHAVRTIGDLSDAANEVAERAVE
15430|gene|hbo      SGHADSEDEYYDQLREATLTATRAAVRERERADDKQLVHAVRAMDDAERTANELAERLAE
1041|gene|hla       SGFADSRDDYYDRLHETSVAATREAVRERERADDQQLVHAVRAMDDCERTANELAERAAE
2064|gene|nph       SGVAADEDDYYEQLHEAAVAATRAAVHEAETADDQQLIHAVRAMDDTERVANELAERVTE
407|gene|hut        TGYADDVDAYYDALHSITTAAAETAVRERERADDQQLKHAVRAMDDCERTANELAERVAE
10864|gene|hma      AGFADDEAAYYDRLHEVTMAATSAAVAEQEGADDQQLVHAVRAMADCERTANELAERVAE
1502|gene|hhi       AGFADDEADYYDRLHEVTMAATSAAVAEREGADDQQLVHAVRAMADCERTANELAERVAE
                       . .   **: *.. : :*:  ** . * :**.** *.: :: * . .***::** .*

2568|gene|hwa       WGGSRIDDSDTGVDTVRELADITPSTPVETRLTSLATQVLMLYEERDDLRTYIETQAATV
1174|gene|nrc1      WARTLFDGVDDGIAGARDVAGRSANSPTEERAIALCERATDLADERDRAQGFVETHAPTV
15430|gene|hbo      WAGTLYDDAGVGIEGARDLADKDPQTPVEDRVVSYARRVADLADERDDLRAFVESRAPAL
1041|gene|hla       WAGSLFDDAEPGIEGARAVADREPTGELERRAVSLAARVVDLAAERDALAETIDRIAPAV
2064|gene|nph       WAGDRYDADGTGVEYAASLADADDLD--DPQLRSLAERIRDLAAEADDLRSHVERVTPEI
407|gene|hut        WAGTRLADAGSGVGYARELVTGETSDRADADLVSLAQRVVALDDEAAELRRTIETTAPDV
10864|gene|hma      WGGSRHGDSGSGVEYARSLADREDEDEGDRALRSLAEQTAALADEADSIRAYIERTAPAV
1502|gene|hhi       WGGSRHGDSGSGVEYARSLADRDDEDEGDTALRSLAGQTAELADEADSLRAYIERTAPAV
                    *.         *:  .  :.        :    : . .   *  *       ::  :. :

2568|gene|hwa       APNLTAMAGPVLATRLIELAGGLKSLARQPAGTIQVLGAEDALFAHLEGRASAPKHGAIF
1174|gene|nrc1      APNLSMLAGPVLAARLIALAGGLDDLAKLPSGTVQVLGAEDALFAHLRGHAPSPKHGVIY
15430|gene|hbo      APNLAEMAGPVLAARLIALAGGLERLAKMPSGTVQVLGAEDALFAHLEGRGSSPKHGVIY
1041|gene|hla       APNLAEMAGAELAARLIALAGGLEPLAKKPSGTLQVLGAEDALFAHLSGRAPSPKHGIIY
2064|gene|nph       APNLARLAGPVLAARLIALAGGLKQLARKPAGTVQVLGAEEALFAHLRGRAPSPKHGVIY
407|gene|hut        APNLSALAGPVLAARLISLAGGLEPLAKKPSGTVQVLGAEDALFAHLQGSAPSPKHGIIY
10864|gene|hma      APNLSMLAGPVLAARLISLAGGLEALAKKPSGTVQVLGAEDALFAHLKGSAPSPKHGVIF
1502|gene|hhi       APNLSMLAGPVLAARLISLAGGLEALAKKPSGTVQVLGAEDALFAHLKGNAPSPKHGVIF
                    ****: :**. **:*** *****. **. *:**:******:****** * ..:**** *:

2568|gene|hwa       THEYVRGTHPANRGSAARAFAGKLAIAARIDHYSGTHKQSIHDELTDRIETIRARNKEDT
1174|gene|nrc1      THEYVRGTHPDQRGSAARALAGKLTIAARVDHYSGDRRPDLEAELDARMERIRARETE--
15430|gene|hbo      VHEYVRGTHPEHRGSAARAFAGKLAIAARIDHYSGEFKSEIHEELAERMETIRAREVAE-
1041|gene|hla       THEYVRNTRPEDRGSASRALAGKLTLAARVDHYSGERRETLHEELRERMATIRARAKDES
2064|gene|nph       THEAIQGTAPAHRGSAARALAGKLTIAARIDHYSGERNPELEADLRDRIERIQARDAE--
407|gene|hut        THEYVSGTVPAQRGSAARALAGKLTIAARIDHYSGDRRPELDAELDDRIETIRSRGEGA-
10864|gene|hma      THEYVRGTRREDRGSAARAFAGKLSIAARIDHYSGDRRPDLQVELDERIERIQARAEEGD
1502|gene|hhi       THEYVRGTRRADRGSAARALAGKLSIAARVDHYSGDRRPDLQAELDGRIERIQARAEEGD
                    .** : .*    ****:**:****::***:*****  .  :  :*  *:  *.:*     

2568|gene|hwa       A-------
1174|gene|nrc1      --------
15430|gene|hbo      --------
1041|gene|hla       DAAAEGDA
2064|gene|nph       --------
407|gene|hut        --------
10864|gene|hma      DE------
1502|gene|hhi       E-------