HOG Organism Gene ID Name Annotation
aHOG3267 hbo HBOR23440 Hbor_23440 PAS domain S-box
>23440|gene|hbo
MVDQSLDSYRLELALENLGAVLWEWDPETDTAVTHPSADGFFGRDISSFDELSEIIHPED
REQVVETLESSLETGASFNIEFRILVDDEVQVIETRGSIRREPEMGSPRVVGIATDITER
KRRETEFQTIVEQSSDVIAVVDDTGVIEYVSPAVRRVFGYETDEILGANISDLIYPPDRD
DALPVLLGSGMTDKNSPERVEYRLRHGDGSVRWVESRVSPRGDAMSSNLVINTRDITERV
EVEQNLKRADESRSLALEASQAGIWDWEIGSERVNWHSSCERVFRVPEGGFEGTYEAFAR
RVHDDDLPAVEAAINRTVNEGEPYHVDYRIIRDDGVERWITARGKVLSDSSGNPTRLLGV
VIDITEQKEREQELKQYERIVETAPDPIYVLDETGDFTLVNEALAAAVGCSKEELIGTSI
GDQLESADAEESLQRIMALSDEESDSPPLDLTLSTPDGTRDYEVNIALSGDDQRGDAPRT
VGVARDVTDIKEHKRRLSVMDRVLRHNIRNKLNIILAHSNFLTEYPDQDIQNRAETILEA
GESLESLSESARRFKASTHPNQSSIRTTNVADCVTHVVDEAQRQFPHATIRVHQEAEVWA
EVHEAFELALTELVENAIRHSDRSAPTVEITVEKHESTVSVQVSDDGPGLTDMEQNVVLE
GEETALEHGSGLGLWLVRWTIANSGGTIDVRNNDPTGTVVEARVPRDSS