HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0325COG1777arCOG01684Predicted transcriptional regulatorstranscriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0325 nrc1 VNG1843 arlR13 transcriptional regulator
cHOG0325 hmu HMUK1374 Hmuk_1374 transcriptional regulator, MarR family
cHOG0325 hma RRNAC3447 arsR transcription regulator
cHOG0325 hwa HQ2779A transcription regulator
cHOG0325 hla HLAC1852 Hlac_1852 transcriptional regulator, ArsR family
cHOG0325 hbo HBOR09010 Hbor_09010 transcriptional regulator, ArsR family
cHOG0325 hut HUTA3005 Huta_3005 transcriptional regulator, MarR family
cHOG0325 hvo HVO_2514 HVO_2514 conditioned medium-induced protein 2
cHOG0325 nph NP2490A hypothetical protein
cHOG0325 hhi 673 arsR4 ArsR family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


1843|chp|nrc1       MDSGALLDLLGNENRRRILQLLARKPCYVTEISEYIGVSPKAVIDHLQQLDDAGLVESRV
1852|gene|hla       MDSAVLLDLLGNENRRRILRLLATKPCYVTEISEYLDVSPKAVIDHLRKLDEAGLVESTT
2779|gene|hwa       MDSAVLLDLLGNENRRRILRLLSHKPCYVTEISEYLGVSPKAVIDHLQKLEDADLVESRT
9010|gene|hbo       MDSAVLLDLLGNENRRRILRLLSHKPCYVTEISEYLGVSPKAVIDHLRKLEDAGLIESRT
13447|gene|hma      MDSAELLNLLGNANRRRILKLLAHKPCYVTEISEYIGVSPKAVIDHLQKLEDAGLIDSRT
673|gene|hhi        MDSAELLNLLGNANRRRILKLLAHKPCYVTEISEYIGVSPKAVIDHLQKLEDAGLVDSRT
2490|hp|nph         MDSAALLDLLGNENRRRILRLLARRPCYVTEISDYLGVSPKAVIDHLRKLEEAGLVESHV
3005|gene|hut       MESAELLDLLGNANRRRILRLLARKPCYVTEISDYLGVSPKAVIDHLRQLEEAGLVESRT
                    *:*. **:**** ******.**: .********:*:.**********.:*::*.*::* .

1843|chp|nrc1       DDQRRKYFHIAENLRLEVQLSPFGYGAKSAYPASTDLDLAR-CQYVSVRIEE--------
1852|gene|hla       DDQRRKYFRIAQSLRLEVSVSPYGFGAKSAYPAKNSFDMASRCQHLSIEIPD--------
2779|gene|hwa       DERRRKYFHIARNLRLEVSVSPHGFGAKSAYPASRSLDMRGRCQYLTIDVLDAI-TDGDS
9010|gene|hbo       DDQRRKYFHISRNLRLEVNVSPYGFGAKSAYPASPNLDMSGRCPHLSFDIP---------
13447|gene|hma      DDQRRKYFSIARNLRLEVRVSPYEFGTKSAYPANPEFEMPS-CRHLSIDVG---------
673|gene|hhi        DDQRRKYFSIARNLRLEVRVSPYEFGTKSAYPANPEFEMPS-CRHLSIDVG---------
2490|hp|nph         DDGRRKYFSIARNLRLEVNVTPYDFGTKSAYSASPNLDITS-WKHVSLHVERATQAAAEL
3005|gene|hut       DERRRKYFYISRGFRLEVTASPYDFGTKTAYPASSGLDITS-CKHLSIDVD---------
                    *: ***** *: .:****  :*. :*:*:**.*.  :::     :::. :          

1843|chp|nrc1       ----------------------------------------RDSNAEVNELAAKLKELNEL
1852|gene|hla       ---------------------------------------DSGSSSDLADLAGEYGRLQDL
2779|gene|hwa       EDTTDSNSKSRRSSAQNRKRTQVHEESESRTVETTERVSSPSQSTDISTLMQQYRRLNDL
9010|gene|hbo       ----------------------------------------REDAQDLNELARELGHLADL
13447|gene|hma      ----------------------------------------EEAGGNFHDLARELEHLQQL
673|gene|hhi        ----------------------------------------STSDGDFHDLARELEHLQQL
2490|hp|nph         NSEEETEDTDIRTDAAGASDSPPADVADGASDSDSPGDADQPPNADLAGLAADLEQLERL
3005|gene|hut       ----------------------------------------PDGASELPELAVEMRRLRRL
                                                                 :.  *  .   *  *

1843|chp|nrc1       ERELSMAQRWVQGQLADVQAALGDAI-GDGPDRLYADVLAALADDSRTARDVAEALEAPV
1852|gene|hla       DRELSLAQRWVQGRVEDTLAEIDERLGTESDSRFFAAVLDALVETDGTPAAVANEVGARE
2779|gene|hwa       ESELSLAQRWVHGRLTDILDTLDTQLDAEADIRFYADVLATITTEAKSTSAIASHINADG
9010|gene|hbo       ENELSLAQRWVHGRITDVLDRLNERIGADADSRFYAETLAAIARGEQTVDGVARELNASP
13447|gene|hma      ENELSLAQRWVQARLTDVRDRIDSGF-ENGDGRLYAELVSGLANGIDTVPALAREIEAPP
673|gene|hhi        ENELSLAQRWVQARMTDVRDRIDSGF-ANGDGRLYAELVSGLANGIDTVPALAREIEAPP
2490|hp|nph         ENELSMAQRWVQGRLTETLDRISDHF-DGVDGRFYAELLRGLATGPEPPDRLAQRVDAPP
3005|gene|hut       RNELSLAQRWVQGRLTDVMEQVSDEI-DDSDDRLYVEVMGAIADGGADLESISRQVEVPP
                      ***:*****:..: :    :.  :      *::.  :  :.        ::  : .  

1843|chp|nrc1       PLIDGVLQTLADRGLVVERADGEYAIAE----
1852|gene|hla       ETVADALHQLADVGVVAR--DGSADVDHYRIR
2779|gene|hwa       DRVETALEHLAHHEFVTRGPDRQWRIDK----
9010|gene|hbo       EAVEEAVHRLAERGLISREDEG-WVVAGSPVA
13447|gene|hma      EIVEEALTRLADDNVVERTDDG-WEIV-----
673|gene|hhi        EIVEEALTRLAEDDVVERTDDG-WEIV-----
2490|hp|nph         DVVADALEGLAAHGVVERDGDQ-WRLNV----
3005|gene|hut       PVVEDILGSLQSRGVVERDGDQ-WVLGR----
                      :   :  *    .:    :    :