HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0324COG0083KOG1537arCOG01027Homoserine kinasehomoserine kinase

HOG Organism Gene ID Name Annotation
cHOG0324 nrc1 VNG1797 thrB homoserine kinase
cHOG0324 hmu HMUK1644 Hmuk_1644 homoserine kinase( EC:2.7.1.39 )
cHOG0324 hma RRNAC3348 thrB homoserine kinase
cHOG0324 hwa HQ3322A thrB homoserine kinase
cHOG0324 hla HLAC2302 Hlac_2302 homoserine kinase
cHOG0324 hbo HBOR07480 Hbor_07480 homoserine kinase( EC:2.7.1.39 )
cHOG0324 hut HUTA0058 Huta_0058 homoserine kinase
cHOG0324 hvo HVO_2338 HVO_2338 thrB homoserine kinase
cHOG0324 nph NP4524A thrB homoserine kinase
cHOG0324 hhi 588 thrB homoserine kinase
MUSCLE (3.6) multiple sequence alignment


1797|gene|nrc1      -----------------------------MVV-TVRAPATSANLGSGFDVFGVALSKPAD
2302|gene|hla       -----------------------------MV--TVRAPATSANLGSGFDVFGAALTRPAD
3322|gene|hwa       -----------------------------MRMETVRAPATSANLGSGFDVFGVALDRPAD
7480|gene|hbo       -----------------------------MR--TVRAPATSANLGSGFDVFGVALDRPAD
58|gene|hut         -----------------------------MR--TARAPATSANLGSGFDVFGIALSRPAD
4524|gene|nph       -----------------------------MI--TVRAPATSANLGSGFDVFGAALERPAD
13348|gene|hma      MPLGRVLSTGKRPQCRFATFLPTLLKFAGML--TVRAPATSANLGSGFDVFGVALERPAD
588|gene|hhi        -----------------------------ML--TVRAPATSANLGSGFDVFGVALERPAD
                                                 *   *.***************** ** .***

1797|gene|nrc1      VVRVERADTTTITVTGAGAQYVPTDPQENTAGVVAAALDAPATIHINKGVRPSSGLGSSA
2302|gene|hla       VVTVEKAAETTIEVTGVGAQYIPEDPKKNTVGAVVEALDAPARIHIDKGVRPASGLGSSA
3322|gene|hwa       IVRVERADKTTIEVTGVGSQYIPEDPHSNVVGAVAEALDAPAQIQIDKGVRPSSGLGSSA
7480|gene|hbo       VIRVEKASRTTIEVTGVGSQYIPEDPEKNVVGAVAEALDAPAHIQIDKGVRPSSGLGSSA
58|gene|hut         VVRVERADRTTIEVTGAGSQFIPEDPEKNTVGAVAEALDAPAHIQIDKGIRPASGLGSSA
4524|gene|nph       ILRIEKANRTTIRVTGVGSKYIPEDPEKNTVGAVAEALDAPAHIEIDKGVRPASGLGSSA
13348|gene|hma      VVRLEKADRVTIDVTGAGSQYIPEDPDKNTVGAVADALDAPARIQIDKGVRPASGLGSSA
588|gene|hhi        VVRLEKADRVTIEMTGAGSQYIPEDPDKNTVGAVAEALDAPARIQIDKGVRPASGLGSSA
                    :: :*.*  .** :**.*::::* ** .*..*.*. ****** * *:**:**:*******

1797|gene|nrc1      ASAAAATVALAELYDRPLDDDALVRAAAQGEAAASGVAHADNVAPAILGGFTIVREDGIE
2302|gene|hla       ASAAGAAVALNRLYDRGLSRSELVPIAAEGEAVVSGVAHSDNVAPSILGGFTVTTSEGTH
3322|gene|hwa       ASAAAAAVALNGLYDRGLSRTELVPIAAEGEAIVSGEAHVDNVAPALLGGFTIARNSTVT
7480|gene|hbo       ASAAGAALALNALYDRGYSRSELVPAAAEGEAVVSGEAHVDNVAPALLGGFTVAREDEVT
58|gene|hut         ASAAAAAVALNDLYDRGKSRKELVPIAAKGEAVVSGDAHDDNVAPAILGGFTIATPDGVT
4524|gene|nph       ASAAAAAVGLNELYDRGLSREELVPIAAEGEAVVSGAAHADNVAPSIMGGFTVAREDGVT
13348|gene|hma      ASAAAAAVGLNELYDRGYSREELVPIAAKGEAVVSGDAHDDNVAPSIMGGFTIATDKGVT
588|gene|hhi        ASAAAAAVGLNELYDRGYSREELVPIAAKGEAVVSGDAHDDNVAPSIMGGFTIATEKGVT
                    ****.*::.*  ****  .   **  **:*** .** ** *****:::****:.  .   

1797|gene|nrc1      HVDASLALAVCLPETTVSTRDARGVVPESAAMEAVVSTVESAATLTLGMCENDPQRVGRG
2302|gene|hla       AVDASIPLVVCLPDVAVSTRDARRVVPETASMDDLVETVGNAATLAIGMCRSDPDLVGAG
3322|gene|hwa       TVDTTIPLVACLPEIAVSTRDARRVVPDSITMEEAVHTVGSAATLTVGMCQSNPALVGAG
7480|gene|hbo       TVDTDISLVACLPEIAISTRDARRVVPTRADMEDVVHTVGSAATLAVGMCRSDPELVGRG
58|gene|hut         QIDTDISIVVTLPEIVVSTRDARKVVPTETTVEKLVETVGNAATLTAGMYRDDPALVGRG
4524|gene|nph       QVDASIPLVACLPEIVVSTRDARGVVPEAAPMEAVVDVVGNAATLAVGMARDDPALVGRG
13348|gene|hma      QVDADIPLVACLPDIVVSTRDARNVVPETARVDQMVETVGNAASLTTGMHRDDPELVGQG
588|gene|hhi        QVDADIPLVACLPDIVVSTRDARNVVPETARVDQMVETVGNAASLTTGMHRDDPELVGQG
                     :*: :.:.. **: .:****** ***    ::  * .* .**:*: **  .:*  ** *

1797|gene|nrc1      VEDALVTPARARLMDGYEAASAAARDAGATGVTISGSGPGVVAVCRRRDRKRVAAALVDG
2302|gene|hla       MSDPVVTPERARLITGYDEVRAAAFDAGATGVTVSGAGPAILAVCRDGQRRGVAAAMLDA
3322|gene|hwa       MDEHVVTPARAELVTGYDTVREAALTAGATGVTVSGAGPAILAVCKAERRRAVAAAMIDA
7480|gene|hbo       MDERLVTPARSELITGYENVRTAALDAGATGVTVSGAGPSVLAACYPDDRRQVAAAMVDG
58|gene|hut         MEDDVVTPARAKLIDGYDAVRDAALAAGATGVTISGAGPAVLAVTRSRDQRSVANAMLDT
4524|gene|nph       MEDSIVTPERAELINGYETVRSAAENAGATGVTISGAGPTVIAACHRGDRTAIASAMLDA
13348|gene|hma      MHDTVVTPARAKLIDGYEQVREAALAAGATGVTISGAGPTVIAACAEEDRRQIASTMLDA
588|gene|hhi        MHDTVVTPARAKLIDGYEQVREAALTAGATGVTISGAGPTVIAACAEEDRRKIASTMLDA
                    : : :*** *: *: **: .  **  *******:**:** ::*.     .  :* :::* 

1797|gene|nrc1      FDSAGVAASAYQTRIGDGATRLAADGDDRAP
2302|gene|hla       FSDAGIDSRAYQTRIGRGSTVLEE-------
3322|gene|hwa       FETADVEARAYQTCVSAGATLF---------
7480|gene|hbo       FDDAGVEARAYQTRVGGGAVVF---------
58|gene|hut         FDARGIDARAYQTRIGNGTRLY---------
4524|gene|nph       FSEAGVEARAYKTEIGRGAELF---------
13348|gene|hma      FGERGVDARVYQTRIGGGAEVF---------
588|gene|hhi        FGDCGVDARVYQTRIGGGAEVF---------
                    *   .: : .*:* :. *: