HOG Organism Gene ID Name Annotation
aHOG3238 hbo HBOR14010 Hbor_14010 hypothetical protein
>14010|hp|hbo
MITGETMTDTIAIEELLRYAAERRLLREELDDDRLDTDTMIDVVRHGPVLETLYGQSLDR
RDVEDSLGVSRATSHRLTRWLVEEGLAERRDGTFSLTGKGEVYADELLRLDRNLRAAERL
APLLDCICETHREFVVEPFADATITEATPNDPYRPVSRFLELLAESDTFRGFNTTHVVPP
GTPGAEDQLFDTDDAEFIG