HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0323COG1676KOG4685 KOG4133arCOG01701tRNA splicing endonucleasetRNA intron endonuclease

HOG Organism Gene ID Name Annotation
cHOG0323 nrc1 VNG2210 endA tRNA intron endonuclease
cHOG0323 hmu HMUK0666 Hmuk_0666 tRNA intron endonuclease( EC:3.1.27.9 )
cHOG0323 hma RRNAC2964 endA tRNA splicing endonuclease
cHOG0323 hwa HQ1047A endA tRNA splicing endonuclease
cHOG0323 hla HLAC2070 Hlac_2070 tRNA intron endonuclease
cHOG0323 hbo HBOR03050 Hbor_03050 tRNA intron endonuclease( EC:3.1.27.9 )
cHOG0323 hut HUTA1669 Huta_1669 tRNA intron endonuclease
cHOG0323 hvo HVO_2952 HVO_2952 endA tRNA-splicing endonuclease
cHOG0323 nph NP0444A endA tRNA splicing endonuclease
cHOG0323 hhi 224 endA tRNA splicing endonuclease
MUSCLE (3.6) multiple sequence alignment


2210|gene|nrc1      ---------MDGDLRGDTVHIGGDARQRFHDARGYGYPLGGNDIAVSLVEAAHLLFRGDL
2070|gene|hla       -----MDMQPTGHLRGDAVHVAGDARQRFHDSNGYGRPLGGNEIALSRVETAHLLFRGDL
1047|gene|hwa       ---------MEGTLVDGTVQVGADAKQRFHDARGYGRMRDSTIVELAPVEAAHLLARGDL
3050|gene|hbo       MSSPGAFSNMDATLHDDVVRVGDDARQRFYDSRGYGRPLDGNRLELAPVEAAHLLSRGDL
2952|gene|hvo       ---------MQGRLEDGVVHLPGDARQRFHDSRGYGRPTGGDDLEVAPVEAAHLLSRDDI
444|gene|nph        ---------MEGHLSDGLVEVGPNGRERYYDSSGYGRPDGAG-VRLAPVEAAYLLARGDL
1669|gene|hut       ---------MELVLEGDVVRGGSEARERFYDSRGYGHVDGGG-LALSPVEAAHLLYRGDV
12964|gene|hma      ---------MELTLEGDVVRAGYEARERFYDSRGYGKVRNGD-IDLAPVEAAHLLYRGDI
224|gene|hhi        ---------MELTLDGDVVRAGYEARERFYDSRGYGKVRNGD-IDLSPVEAAHLLYRGDI
                                 * .. *    :..:*::*: ***   ..  : :: **:*:** *.*:

2210|gene|nrc1      DSV------DG---------------------------------MGFRAFLTDREAG---
2070|gene|hla       SGVSLTPDADP---------------------------------VGFERFFVESAAAADR
1047|gene|hwa       ETVIIDASSCAGETVSVDDINTTPHIGASDTSGPHSADDSSTYHVGFRGFLAYTDAA---
3050|gene|hbo       DDI------DG---------------------------------MEFREFLAETGAA---
2952|gene|hvo       DGV------DG---------------------------------MGLRELLARTGTT---
444|gene|nph        DAV------DG---------------------------------MGLEAFLADTPDL---
1669|gene|hut       EHIRDGRSDEA---------------------------------LDFQALLSSAAVS---
12964|gene|hma      ESI------DG---------------------------------MDFRGFLGSAAVS---
224|gene|hhi        ESI------DG---------------------------------MDFRAFLGSAAVS---
                    . :                                         : :  ::         

2210|gene|nrc1      FAARFLVYVDLRDRGFYLVPDRDPW----WRDPGD--GDFVVFPRGNTRRDGVVKHRVRV
2070|gene|hla       FAVRYLVYADLRDRGFYLSPAREPWPGGDVDAPDA--VDFVAYERGSTPDTGDVKYPVQV
1047|gene|hwa       --RQFAVYKDLRDRGFYLSPARSSWPG--VDPAVGNQIDFIVYPRGMGPHDDEVAHQIRV
3050|gene|hbo       --LAFVVYKDLRDRGFYLSPAREEWPG--VSDADG--IDFVVYPRGKGPTDGDVEYRIRV
2952|gene|hvo       --LDFVVYKDLRDRGFYLSPAREGWPG--VADAAD--ADFLVYPRGKGPWDGEVEHRVRV
444|gene|nph        -VVPFLVYRDLRERGFYVSPALEGW----VADHAG--IDFVVHPRGDGPWDGTVAYRVRV
1669|gene|hut       -EIDVLVYKDLRDRGFYLSPAREGW----VDGPSG--TDFVVYPRGQGPWDDDVAYRIRA
12964|gene|hma      -EVDFAVYKDLRDRGFYLTPAREGW----VDDAAG--ADFVVYPRGKGPWDNEVAYRVRI
224|gene|hhi        -EVDFAVYKDLRDRGFYLTPAREGW----VDDAAG--ADFVVYPRGKGPWDNEVAYRVRV
                          ** ***:****: *  . *             **:.. **     . * : :. 

2210|gene|nrc1      VDERTTLPVDGLSESVLAVVDEESEITYLDIA-----------PETPTGETTLD------
2070|gene|hla       VGERESLPAAGLAGRTLAVVDEESDITYFAAT-----------RGEIAGATDYE------
1047|gene|hwa       IGERETVSMSALGDVVLAVVDEDGELTYFETNSNSAFHEVISHDEDNTDSKDIDLSEIND
3050|gene|hbo       IGERERVAAASLGDVVLAVVDEDGDLTYFDTDD----------DPDVGGTDDYI------
2952|gene|hvo       VGERESIPVSSLGEVVLAIVDEDGDLTYFDTE-----------GDDPEGTAAED------
444|gene|nph        VDERGSVRLDSLGDVVLAVVDEESELTYLETD-----------RPAVDGTSGLE------
1669|gene|hut       ISERTAVSAATLGDSVLAVVDEESAITYLETS-----------HPDIAGSSTTD------
12964|gene|hma      IGERDTAVATDLGGCVLAVVDEESEVTYLDTD-----------RREVSGTSDAA------
224|gene|hhi        IGERDTVDATALGGCVLAVVDEESEVTYLDTD-----------RREVSGTSDAA------
                    :.**       *.  .**:***:. :**:                   .           

2210|gene|nrc1      ---------RPTDVPGVLLDDRVLVWEPPQRLHNAGFYGQPLGGRAADHD-ALQLSLVEA
2070|gene|hla       ---------PPDQLDGVLLSDRVVVWDAPEGLYERGFYGQPLTGRAAAVEGAVQLSLVEA
1047|gene|hwa       NQTIQDQSSLPADLSADVIHDRVVCYDATDSLYDENFYGQRLFGRNADTG-PIQFSLIEA
3050|gene|hbo       ---------PPEGLDADLLSDRVVCYESPDEVYENGFYGQRLFGRNAEEG-PLQLSLIEG
2952|gene|hvo       ---------LPADLDAELLSDRALVWDGVDRLYQRGFFGQRLYGRNADSG-PLQLSLLEA
444|gene|nph        ---------ADLTADGVLLEDRVLCWDAPPALYEQGFYGQRMDR---EDG-PLQLSLLEA
1669|gene|hut       ---------LPSGVAADLLGDRVLAPDPPEALYFEGFYGQPLDD---EAGEPLQLSLIEA
12964|gene|hma      ---------VPAT-AGELLGERVVCWEPPAELYEQAFYGQQLG----DDG-AVQLSLVEA
224|gene|hhi        ---------VPAT-AGELLGERVVCWEPPAELYDQAFYGQQLG----DDG-AVQLSLVEA
                                   . :: :*.:  :    ::   *:** :         .:*:**:*.

2210|gene|nrc1      AYLIDAGVLRL-----------------TDATIDDVRARGRLGEGEHFDCRLAVYRALRD
2070|gene|hla       ASLAADGVLSLSTSVGTAGESPSEGAAETDGPVAAVVARGRDVEGERFDRRLAVYKRLRA
1047|gene|hwa       AYLAQQGVIAV------------------D--TATIVAIGRDVEGERFDRRLRVYAALRN
3050|gene|hbo       AYLARRGVIDV------------------D--DEEVVALARDVEGDRFDRRLKTYAALRD
2952|gene|hvo       AYLARADALAI------------------D--EADVVSRGRDVEGDRFDRRLAVYAALRE
444|gene|nph        AHLAATGVLSV------------------AGGAAAVEARGRDAEGERFDRRLTVYRTLRE
1669|gene|hut       AALASQGVLDV------------------EGGADAIVECGREVEGERFDRRLAVYRALRE
12964|gene|hma      AYLTQEGMLTV------------------EGGADAVVERGREVEGDRFDRRLAVYTALRA
224|gene|hhi        AYLAQEGLLTV------------------DGGADAVVGRGREVEGDRFDRRLAVYTALRA
                    * *   . : :                        :   .*  **:.** ** .*  ** 

2210|gene|nrc1      AGAVPKTGFKFGADFRVYSAVSSVDDLGHSELLVRVITDTHVFSPGDLSLDVRLAHGVRK
2070|gene|hla       ADAVPKTGFKFGADFRTYLDVETVEDLPHSEHLVRVVEGDHRFSPRELSLDVRLAGGVRK
1047|gene|hwa       HDTVPKSGFKFGADFRVYRTFDGIDSLDHSTDLIRVCQTDMKIYPRDLSLDIRLAGGVRK
3050|gene|hbo       AGSVPKSGFKFGADFRVYTDFETVSSLSHSADLVRVVTPDHAFFPRDLSLDVRLAGGVRK
2952|gene|hvo       AKTVPKSGFKFGSDFRVYTEFESVDDLSHSEFLVRVVAPDHTFVPRDLSLDVRLAGGVRK
444|gene|nph        RGVVPKTGFKFGADFRTYADVDSVSELGHSELLVRVLPADATLSPRDVALDVRLAHGVRK
1669|gene|hut       RGVVPKTGYKFGADFRTYADVESVDSLGHSELLVRVLPADHAFTPRDLALDVRLAHGVRK
12964|gene|hma      SGVAPKTGFKFGADFRTYADVESAENLGHSELLVRVLPADHRFEPRDLALDVRLAHGVRK
224|gene|hhi        SGVAPKTGFKFGADFRTYADVESAENLGHSELLVRVLPADHRFEPRDLALDVRLAHGVRK
                       .**:*:***:***.*  ..  ..* **  *:**      : * :::**:*** ****

2210|gene|nrc1      RMVFAATDDTDD----------------------TIRWLSVSRLTP
2070|gene|hla       EMVFALTMVEGDGSGAGGDGGDDETAENGAVRDADVEWLSIGRLTP
1047|gene|hwa       RMVFALTPANG-----------------------DIHWLSVARLTL
3050|gene|hbo       RMVFALTDAND-----------------------GIDWLSVARLTP
2952|gene|hvo       RMVFALTDDNG-----------------------EIDWLSVSRLTP
444|gene|nph        RMVFALVDDGD-----------------------EIRWVSVSRLTP
1669|gene|hut       RMVFALVAEADADGDP------------------RIEWLEVGRLTP
12964|gene|hma      TMVFALTTDGGD----------------------EIEWVAVERLTP
224|gene|hhi        TMVFALTADGGDGSGDSGNGN-------------DLEWIAVERLTP
                     **** .   .                        : *: : ***