HOG Organism Gene ID Name Annotation
aHOG3223 hbo HBOR16070 Hbor_16070 hypothetical protein
>16070|hp|hbo
MTTDADADEAVETEGEPADSETTDEAAFDGESTDSEAAGTGSASQTDLNNGYDDTVPNVE
LGLYQLSVRVSGRSEDDLQSVEDSAKRLMDYLIDRAEELEERPDDRGLS