HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0322COG1920arCOG04472Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0322 nrc1 VNG1935 vng1935 no entry
cHOG0322 hmu HMUK1414 Hmuk_1414 phospholactate guanylyltransferase (EC 2.7.7.-)
cHOG0322 hma RRNAC3282 hypothetical protein
cHOG0322 hwa HQ3149A hypothetical protein
cHOG0322 hla HLAC1893 Hlac_1893 protein of unknown function DUF121
cHOG0322 hbo HBOR06400 Hbor_06400 phospholactate guanylyltransferase
cHOG0322 hut HUTA1302 Huta_1302 phospholactate guanylyltransferase (EC 2.7.7.-)
cHOG0322 hvo HVO_2202 HVO_2202 conserved protein
cHOG0322 nph NP2400A hypothetical protein
cHOG0322 hhi 521 HAH_0521 putative phospholactate guanylyltransferase
MUSCLE (3.6) multiple sequence alignment


1935|chp|nrc1      MRTVVPFDPRDPKSRLAEFFADAEERRGFAYAMLADVLGAVRDAGGDPVVV---------
3149|hp|hwa        MHVIVPYTDVSPKTRLNSIL-TASERTAFAQAMLYDVISTLQSNGHTVELLIPTETVMQA
13282|hp|hma       MRLAVPVSGSTPKTRLASVL-SPDERRDFTEAMLADVVDAVTSAGHEPEVI---------
521|gene|hhi       MRLVVPVSGSDPKTRLASVL-SPDERRDFTEAMLADVVDAVTAAGHEPDVI---------
1302|gene|hut      MHVVVPFDGRDPKTRLAPVL-DAPERRDFARAMLADVAETIESISFEPTIL---------
2400|hp|nph        MDVLVPFAAREPKTRLAGTL-DADERAAFARAMLLDVCDAVEAAGGEPTVL---------
6400|gene|hbo      MQVVIPYTTRDPKSRLAGVL-DEDERRAFARAMRTDVVRAVRAAGGAPTIL---------
1893|gene|hla      MEVIVPFSTERPKSRLSAVL-TPDERAAFARTMLQDVLAAIDAADGEPRIL---------
                   *   :*     **:**   :    **  *: :*  **  ::   .    ::         

1935|chp|nrc1      ------------------------------------------------------------
3149|hp|hwa        TDQRDQETIIDSTGVSTEAVSTSTSTHADTTEHNAASDNYVSQSPTHTLSVTPEAIMRIL
13282|hp|hma       ------------------------------------------------------------
521|gene|hhi       ------------------------------------------------------------
1302|gene|hut      ------------------------------------------------------------
2400|hp|nph        ------------------------------------------------------------
6400|gene|hbo      ------------------------------------------------------------
1893|gene|hla      ------------------------------------------------------------
                                                                               

1935|chp|nrc1      --------------------------ATAPVSR-PVDAPVTVDDRALSTAVAAAIA----
3149|hp|hwa        RDDDDPDNEASTQERDGDKEYIDITVDTAQNQIQSNQIVVTADDRALTPAVNSCLNRLSD
13282|hp|hma       --------------------------STAPLDC---AVPVTVDDRGLDPLVNDLLA-STV
521|gene|hhi       --------------------------STAPLDC---AAPLTVDDRGLDPLVNDLLA-SIV
1302|gene|hut      --------------------------ATTDVEC---EWPVVVDERSLDAAVNDQLA----
2400|hp|nph        --------------------------ATEPLAI---EQPVVVDKRPLTPAIDAHLS----
6400|gene|hbo      --------------------------TTDADDIDDVDAPVIGDDRALTPAVNAVLD----
1893|gene|hla      --------------------------ATGAVGI-DLPSPVEIDDRPLTDAVNAAIDARLG
                                              *           :  *.* *   :   :     

1935|chp|nrc1      -DGP-LPTAVVMADLALATPDAIRRVFAA--SGDVVLAPGSGGGTNVVLARTADVPVSYH
3149|hp|hwa        TETPFSELAVVMADLALITPTAIERLFAR--EGDIVLAPGRGGGTNAIVVRHPAFRVDYH
13282|hp|hma       TDDE-GALAVVMADLPLVTRESIERLLAP--EADVVLAPGLGGGTNAFVCRHPEFRVDYH
521|gene|hhi       TDGD-GALAVVMADLPLVTPKSIERLLAP--DADVVLAPGLGGGTNAFVCRHPEFRVDYH
1302|gene|hut      -VAD-GPVAVVMADLALVTPDALDRLFRA--GGEVVLAPGRGGGTNAFVARHHDFRVDYH
2400|hp|nph        -----PPAAVVMADVALVTPAALRRLFAT--TGDVVIAPGLGGGTNALVVRADGFTVDYH
6400|gene|hbo      -DAT-SDVSVVMADLALVTPDALRRLFES--EGEVVIAPGRGGGTNALVVRHPDFRVDYH
1893|gene|hla      NDGA-ERVAVVMADLALATPNALRELFAAGREAEVAIAPGRGGGTNAFVAGHPAFRVDYH
                           :*****:.* *  ::  ::     .::.:*** *****..:     . *.**

1935|chp|nrc1      GVSFRDHVTAAERAGLTVTTVDSFRLAADVDDASDLVDVFVHNT-----RRTREWLIAGG
3149|hp|hwa        GTSYRDHYQAATDASLSVGVVDSMRLGTDIDKPTDLPEVLLHNN-----GMSSVWLQSAG
13282|hp|hma       GASIRDHRETARDVGASVTEVDSRRLATDIDEPDDLAEVLLHSD-----GAAADWLKQSG
521|gene|hhi       GASIRDHRQIARDVGASVTEVDSRRLATDIDEPGDLAEVLLHSD-----GAAADWLIDAG
1302|gene|hut      DASITDHRSIAEEIGADTVEVDSFRLASDVDEPDDLAEVLLHGE-----GRAAAWLREHG
2400|hp|nph        GTSVRDHRRAAEGAGIDARSVDSFRLAVDIDEPTDLAEVLLHGD-----GRSADWLKNAG
6400|gene|hbo      GASYRDHQAIADDAGLSVTVIDSMRLATDVDEPADLAEVLLHGA-----GNARTWLEDAG
1893|gene|hla      GASYLDHRRIADEIGAGVRVVDSHRLATDVDEPADLAELLIHAEADGDGGRAARWLRDAG
                   ..*  **   *   .  .  :** **. *:*.. ** ::::*         :  **   *

1935|chp|nrc1      WRLAVDD--GTPTVVREPND----
3149|hp|hwa        IELNLDDNTGRVGITRKRKNEDVD
13282|hp|hma       FELTATG--GRVDVERFR------
521|gene|hhi       FSLSLTD--GRVTVSRE-------
1302|gene|hut      FDLSMDE--GRVSVQR--------
2400|hp|nph        FRLAETD--GRTTVERRG------
6400|gene|hbo      FELEVTD--GRVGVTRSD------
1893|gene|hla      FALDTTD--GRVGVRRE-------
                     *      *   : *