HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0320COG0459KOG0364 KOG0356 KOG0357 KOG0358 KOG0359 KOG0360 KOG0361 KOG0362 KOG0363arCOG01258Chaperonin GroEL (HSP60 family)thermosome subunit beta

HOG Organism Gene ID Name Annotation
cHOG0320 nrc1 VNG2096 cctB thermosome subunit beta
cHOG0320 hmu HMUK0971 Hmuk_0971 thermosome
cHOG0320 hma RRNAC2939 cctB thermosome beta subunit
cHOG0320 hwa HQ1387A thsB thermosome, beta subunit
cHOG0320 hla HLAC0416 Hlac_416 thermosome
cHOG0320 hbo HBOR27400 Hbor_27400 thermosome subunit
cHOG0320 hut HUTA2121 Huta_2121 chaperonin Cpn60/TCP-1
cHOG0320 hvo HVO_0455 HVO_0455 cctB Thermosome subunit 2
cHOG0320 nph NP0570A ths_2 thermosome subunit 2 (beta subunit)
cHOG0320 hhi 200 thsB thermosome beta subunit
MUSCLE (3.6) multiple sequence alignment


2121|gene|hut       ------------------------------------------------------------
570|gene|nph        ------------------------------------------------------------
12939|gene|hma      ------------------------------------------------------------
200|gene|hhi        ------------------------------------------------------------
2096|gene|nrc1      MMRSVGAVGEPLVVMCVACPRRGGCVVTVVAAAKSCWCRGVSRNLNPGLCPARRVSVRHS
416|gene|hla        ------------------------------------------------------------
1387|gene|hwa       ------------------------------------------------------------
27400|gene|hbo      ------------------------------------------------------------
                                                                                

2121|gene|hut       ----------------------------------------------MQGQPMIVLGDDAD
570|gene|nph        ----------------------------------------MSQQQQMGGQPMIILGEDSQ
12939|gene|hma      -----------------------------------------MSQRQMQGQPMIILGEDSQ
200|gene|hhi        ----------------------------------------------MQGQPMIILGEDSQ
2096|gene|nrc1      GSCILWCGLPSGRVAAVSLPSDPRRFQRIYIEWQSIYLLNMAQQQRMQGQPMIIMGDDAQ
416|gene|hla        ---------------------------------------------MQQGQPMIIMGDDAQ
1387|gene|hwa       -----------------------------------------MSQRMQQGQPMIIMGEDAQ
27400|gene|hbo      -----------------------------------------MSQRMQQGQPMIIMGEDAQ
                                                                    *****::*:*::

2121|gene|hut       RLKDKDAQSHNISAARAVAESVRSTLGPKGMDKMLVSSIGDVTVTNDGVTILDEMDIENP
570|gene|nph        RMKDRDAQSHNIAAAKAVAESVRSTLGPKGMDKMLVSSMGDITVTNDGVTILEEMDIDNP
12939|gene|hma      RMKDKSAQEHNISAARAVAESVRSTLGPKGMDKMLVSSMGDVTVTNDGVTILSEMDIDNP
200|gene|hhi        RMKDKSAQEHNISAARAVAESVRSTLGPKGMDKMLVSSMGDVTVTNDGVTILSEMDIDNP
2096|gene|nrc1      RVKDRDAQEHNISAARAVADAVRSTLGPKGMDKMLVSSMGDVTVTNDGVTILQEMDIDNP
416|gene|hla        RVKDKDAQEYNISAARGVAESVRSTLGPKGMDKMLVDSTGGVTITNDGVTILQTMDIDNP
1387|gene|hwa       RVKDQDAQEYNIQAARAVSEAVQSTLGPKGMDKMLVDSMGDVTITNDGVTILQEMDIDNP
27400|gene|hbo      RVKDRDAQEYNISAARAVAEAVRSTLGPKGMDKMLVDSMGDVTITNDGVTILKEMDIDNP
                    *:**..**.:** **..*:::*.*************.* *.:*:********. ***:**

2121|gene|hut       TAKMIVEVAQTQEDEAGDGTTTAVSLAGELLKNAEDLLEQDIHPTSIIRGYDMAAKRARE
570|gene|nph        TASMIVEVAETQEDEAGDGTTTAVSIAGELLKNAEDLLEQDIHPTAIIKGFHLASDRARE
12939|gene|hma      TASMIVEVAETQEDEAGDGTTSAVAIAGELLKNAEDLLEQDIHPTAIIKGFNMAATQAKD
200|gene|hhi        TASMIVEVAETQEDEAGDGTTSAVAIAGELLKNAEDLLEQDIHPTAIIKGFDMAATQAKD
2096|gene|nrc1      TAEMIVEVAETQEDEAGDGTTTAVAIAGELLKNAEDLLERDIHPTAIIKGYNLAAEQARE
416|gene|hla        TAEMIVEVAQTQEDEAGDGTTSAVAIAGELLKNAEDLLEQDIHPTAVIKGFNLASEYARE
1387|gene|hwa       TAEMIVEVAETQEDEAGDGTTTAVAIAGELLKNAEELLEQDIHPTAAIRGFNLASEEARS
27400|gene|hbo      TAEMIVEVAETQESEAGDGTTTAVAIAGELLKNAEDLLEQDIHPTAIIKGFHLASQKARE
                    **.******:***.*******:**::*********:***.*****: *.*: :*:  *..

2121|gene|hut       EIDDIAVPVEPDDEEMLKSVAATSMTGKGAELNLDLLSDLVVDTAQAVAVEADDGSTVVD
570|gene|nph        EVDNVATEVDPKDTELLKKVAETSMTGKGAELEKDVLAQLVVDAVQAVTVDTDDGETVVD
12939|gene|hma      ELDDIATEVDPDDEELLKKVAETSMTGKGAELNKELLAQIIVDAVNAVTVEAEDGSVIAD
200|gene|hhi        EIADIATEVDPDDEELLKKVAETSMTGKGAELNKELLAQLIVDAVNAVTVEAEDGSVIAD
2096|gene|nrc1      EVDNVAVDVDPDDKDLIRSVAETSMTGKGAELDKELLSSIIYDAVNQVAVETNDGGIVVD
416|gene|hla        QVDEVATQVDPDDTETLKSVAETSMTGKGAELDKDTLADLVVRAIQGVTVEADDGSHVVD
1387|gene|hwa       EIGEITQAVEPGETELLQKVAETSMTGKSSELDKELLAELVVKTVEAITVEANDGSYVVD
27400|gene|hbo      EVDDIAEAVDPDDEELVKKVAETSMTGKSSELNKELLAELIVDAVKQVTVEADDGTYVVD
                    :: :::  *:* : : :..** ******.:**: : *:.::  : : ::*:::**  :.*

2121|gene|hut       LEFVDIKSAPGRPVDASQIVRGGTIDTDPDHEDMPKEAEDADILLLDAPFTVNEMENDAQ
570|gene|nph        LEFINTETQTGRSAGESELLEGAVISKEPVHADMPTEADDADVLLIDEAIEVEDTDADAS
12939|gene|hma      LEYLNIETQTGSSAGNSELLEGAVIDKDPVHEEMATEAEDADVLLVDTAIELDETEVDAQ
200|gene|hhi        LEYLNIETQTGSSAGNSELLEGAVIDKDPVHEEMATEAEDADVLLVDTAIELDETEVDAQ
2096|gene|nrc1      AANINIETQTGHGVNESQLLRGAAISKDPVHDQMPAAVEDADVLLLNEAIEVEEAEADTS
416|gene|hla        LANLNIETRTGRAAGQSRLLSGAVIDKDPVHEDMPTDFEDANVLLLNDPIEVEEADVDTA
1387|gene|hwa       LENLNIETQTGRAAAESELLNGAAIDKDPVHDDMPTAAAEANILLLNEPIEVEETDVDTQ
27400|gene|hbo      LENVSIETQTGRSASESELLNGAVIDKDPVHDDMPTEFDEASVLLLNDPIEVEEADVDTQ
                       :. :: .*  .  * :: *..*..:* * :*.    :*.:**:: .: ::: : *: 

2121|gene|hut       LSVDDPDQLQEFIEQEEQAIREKVQAVADAGVDVVLSKKSIDEMAQHLLAREGILSISQI
570|gene|nph        LQLDSPDQLQEFIDKEEEQLREKVDAIAATGADVVFCQRGIDDLAEHFLAKEGIIAASRV
12939|gene|hma      LSVDDPSQLQNFLDKEEEQLKQMVDQIADTGADVVFCQKGIDDMAQHYLAEKGILAVRRA
200|gene|hhi        LSVDDPSQLQNFLDKEEEQLKGMVDQIADTGADVVFCQKGIDDMAQHYLAEKGILAVRRA
2096|gene|nrc1      VNIESPDQLQSFLDQEEKQLKEKVQQIADTGANVVFCQKGIDDMAQHYLAKEGILAVRRT
416|gene|hla        VNVESPDQLQRFLDQEEEQLRDKVDKIVESGADVVFCQKGIDDLAQHYLAKEGILAVRRT
1387|gene|hwa       VNIESPDQLQQFLDQEEKQLKEKVEKIADAGADVVFCQKGIDDLAQHYLAKEDILAVRRA
27400|gene|hbo      VNIESPDQLQKFLDQEEKQLKEKVEKIAATDADVVFCQKGIDDLAQHYLAKEGILAVRRT
                    :.::.*.*** *:::**: :.  *: :. :..:**:.:..**::*:* ** :.*::  . 

2121|gene|hut       KRSDLEFLSEVLGTQLHSNLDFESLSAEDLATGDISRDPEDGWYVVE--SDGNHGVTLVI
570|gene|nph        KKSDLSFLKEVTEATIVSDID--TLDAEALGSADVRFDSDEELFYVEGTGDQPHGVTMLL
12939|gene|hma      KKSDIEFLKEVLGARIVSDLD--SASAEDLGHGSVTRDDAEGLFYVEGSGDGAHGVTLLL
200|gene|hhi        KKSDIEFLKEVLGARIVSDLD--SASAEDLGHGSVTRDDAEGLFYVEGSGDGAHGVTLLL
2096|gene|nrc1      KKSDIEFLTNVLDASVVTDLD--AASEADVVAGSVTRDSDDELFYVEGESEQAHGVTLLL
416|gene|hla        KKSDLTFLKNVLGAPIVSDLD--SLTADDLAIGTVSRDTEEGLFYVE--GEDAHGVTLLL
1387|gene|hwa       KKSDVGFLKNVLEASVVSDLD--SVTESDLGYGSVRRDGEDELFYVEGLGSETHGVTLLL
27400|gene|hbo      KKSDIKFLKNVAGGNVVSDLD--SVTEDDLGVASIRRDEEGELFYVEGLGDKTHGVTMLL
                    *.**: **.:*    : :::*  :     :  . :  *     : **  ..  ****:::

2121|gene|hut       RGSTEHVSDELERGITDALDVVAATITDGRVLAGGGATEVELADRLREYADGVSGREQLA
570|gene|nph        RGSTGHVVDELERGIGDALDVVAQTVSDGRVLAGGGAVEVEVARRVRDYADSVSGREQLA
12939|gene|hma      RGSTDHVVDELERGVTDALDVVASTVANGSVLGGGGAPEVEVARRLRDYADSVEGREQLA
200|gene|hhi        RGSTDHVVDELERGVTDALDVVASTVANGSVLGGGGAPEVEVARRLRDYADSVEGREQLA
2096|gene|nrc1      RGSTDHVVDELERGVSDALDVSAQTLSDGRVLPGGGATEVEVASRLRDFADSVSGREQLA
416|gene|hla        YGTTEHVVDELERGIQDAIDVVSTTVSDGRTLPGGGAIEVELASRLRDYADTVSGREQLA
1387|gene|hwa       RGSTDHVVDELERGINDAIDVVSTTVSDGRVVAGGGAIEVEVARRLRDYADSVSGREQLA
27400|gene|hbo      RGSTDHVVDELERGVEDALDVVATTVSDGRVLAGGGAIEVELASRLRNYADSVSGREQLA
                     *:* ** ******: **:** : *:::* .: **** ***:* *:*::** *.******

2121|gene|hut       VEAFADAFDLIPRVLAENAGLDSIDTLVELRSAHE-SGDGHAGLDVFDGDVVDTFEAGVV
570|gene|nph        VEAFADALELVPRVLAENAGLDSIDTLVDLRAAHE-DGDEAAGLDVFSGDVVDTFDAGVV
12939|gene|hma      IESFADALEIIPRTLAENAGLDSIDTLVDLRAAHE-DGDVSAGLNVFSGDVENTLDTGVV
200|gene|hhi        IESFADALEIIPRTLAENAGLDSIDTLVDLRAAHE-DGDVSAGLNVFSGDVENTLDTGVV
2096|gene|nrc1      VEAFADSLELVPRVLAENAGLDSIDTLVDLRSAHENDDDEHIGLNVLSGDLEDTFEAGVV
416|gene|hla        VEAFADSLELIPRVLAENAGLDAIDLLVDLRAAHE-AGDTEAGLNVFSGEVENTTEAGVV
1387|gene|hwa       VEAFADALELVPRVLAENAGLDSIDTLVNLRKAHE-NGDANAGLNVYSSDVEDSFDAGVV
27400|gene|hbo      VEAFADALELVPRVLAENAGLDSIDTLVDLRAAHE-DGDVRAGLNVFTGNVEDTFEAGIV
                    :*:***:::::**.********:** **:** ***  .*   **:*  .:: :: ::*:*

2121|gene|hut       EPAHAKSQAVSSAVEAANLVLKIDDIISATALGEDYEDEDDGQGGGMGGMGGGMGGM-GG
570|gene|nph        ESAHAKQQALSSATEAANLVLKIDDIIAADELSTE-GDEPEGGAGGMGGGMGGMGGMGGG
12939|gene|hma      EPAHAKRQAISSAAEAANLVLKIDDIIAAGELSTS--GGDEGGPGGPGGAPGGMGGMGGG
200|gene|hhi        EPAHAKRQAVSSAAEAANLVLKIDDIIAAGELSTS--GGDEGGPGGPGGAPGGMGGMGGG
2096|gene|nrc1      EPAHAKEQAVTSASEAANLVLKIDDIISAGDLSTD-KGDDDGGAGGMG---GGMG---GG
416|gene|hla        ETAHAKEQAIASAAEAANLVLKIDDIISAGDLSTG-GDGDEGGAPA-----GGMGGM-GG
1387|gene|hwa       EPAHSKEQAIASAAEAANLVLKIDDIIAADELSTS-GDDEEGGPGGAGGM-GGMGGM-GG
27400|gene|hbo      EPAHAKEQAISSAQEAANLVLKIDDIIAAGDLSTS-GGDDEGGAPA-----GGMGGM-GG
                    *.**:* **::** *************:*  *.    .  :*   .     ****   **

2121|gene|hut       MGGMM
570|gene|nph        MGGMM
12939|gene|hma      MGGMM
200|gene|hhi        MGGMM
2096|gene|nrc1      MGGMM
416|gene|hla        MGGAM
1387|gene|hwa       MGGAM
27400|gene|hbo      MGGAM
                    *** *