HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0032COG1473arCOG01108Metal-dependent amidase/aminoacylase/carboxypeptidaseputative aminohydrolase

HOG Organism Gene ID Name Annotation
cHOG0032 nrc1 VNG0437 ydaJ putative aminohydrolase
cHOG0032 hmu HMUK3128 Hmuk_3128 amidohydrolase
cHOG0032 hma RRNAC0659 ama N-acyl-L-amino acid amidohydrolase
cHOG0032 hwa HQ2744A indole-3-acetyl-L-aspartic acid hydrolase
cHOG0032 hla HLAC1411 Hlac_1411 amidohydrolase
cHOG0032 hla HLAC1057 Hlac_1057 amidohydrolase
cHOG0032 hla HLAC1053 Hlac_1053 amidohydrolase
cHOG0032 hbo HBOR18400 Hbor_18400 amidohydrolase
cHOG0032 hbo HBOR06600 Hbor_06600 amidohydrolase
cHOG0032 hut HUTA0880 Huta_0880 amidohydrolase
cHOG0032 hvo HVO_1395 HVO_1395 indole-3-acetyl-L-aspartic acid hydrolase
cHOG0032 nph NP4078A hydrolase / carboxypeptidase
cHOG0032 hhi 1313 ama N-acyl-L-amino acid amidohydrolase
MUSCLE (3.6) multiple sequence alignment


6600|gene|hbo       MTKFADETLTEIRRDLHRHPEEGWKEFRTTALVAEELDERGFD-LALGSDAVTVEERLGV
4078|gene|nph       -MYVPRERLIELRRAFHQHPEPAWREFWTTAKVVSELRDIGVDELHIGREAL-SDERLAV
880|gene|hut        -MTETPEHLKRLRRDLHRHPEPAWREFYTTARILEEIERIGVDEVFVGPDALATNARAGV
10659|gene|hma      MNEAQQERRRSVRRDLHSYPEPAWREFYTTSRIAEEIERIGVDQLYIGRNVVDGDARMAV
1313|gene|hhi       MNESQQERLRSVRRDLHSYPEPAWREFYTTSRIVDELERIGVDQLHLGQDVVDGDARMAV
437|chp|nrc1        MDYTDPAVLTRLRRDLHGIPEPAWCEFQTTARVVDACEDIGVDTLHVGPQAVASDARMAV
1411|gene|hla       MSALDDDGYRAFRRDLHRNPEPAWREFYTTARIVEELRERDLTDLYVGPDALATDDRMNV
2744|gene|hwa       ---MTRAELVTLRRDLHQHPEPAWREFYTTARLVDELETRNLDAIYVGPEVL-GGERRGV
18400|gene|hbo      ---MTSSELVELRRDLHQHPEPAWCEFYTTARLVDELETRDLDALYVGPEVLSEDDRMAV
1053|gene|hla       MNEPIRDRLASVRRRFHRHPEPAWREFLTTATLVDEIRSIGVDELAIGPDAYDPGDRMAI
1057|gene|hla       MSHDARARLSDLRRTFHRHPEPGWREFQTTARVVEELERIGVDEIAVGREALATDARMAV
                               .** :*  ** .* ** **: : .     ..  : :* :.     *  :

6600|gene|hbo       PAADEIAAARERAKREGAPEEYLDRI-GDVTGLVAEKRYGDGPTIGVRVDMDALARSEAS
4078|gene|nph       PDEEELASWRERAREAGADPDLLEELADGWTGCVAAIDCGEGPTVGLRVDIDGLPREEST
880|gene|hut        PDDD-LARWRERASEAGVDEATLDRLDGGQTGAIAVLKRGDGPTVGLRVDIDALPRTESS
10659|gene|hma      PDDDELEDWQRKARDAGAREDVLEAAAGGFTGALAVLEQGEGPTVALRVDIDALPITESD
1313|gene|hhi       PDADELEDWQAKAREAGAREDVLEAATGGFTGALAVLEQGDGPTVALRVDIDALPITESD
437|chp|nrc1        PDDDTLADWRATARDAGVDEALLDSMAGGHTGAIAVLDRGEGPTVGLRVDIDALHITESE
1411|gene|hla       PDDEELAEWEQRARDAGADPEIVDHLSGGYTGCVAVAERGPGPVVGLRVDIDALPVTESE
2744|gene|hwa       PDDNELSTWRARAREAGAREDVLERLSGGRTGVCAVIECGPGPTVGLRVDIDGLPITEST
18400|gene|hbo      PDGDKLTTWFERARDAGAREDILERLEGGYTGAVAVLERGEGPTVGLRVDIDGLPITESE
1053|gene|hla       PDGD-LDPWIERARDRGADDALLDRMTGGNTGAVAVLDRGEGPAIGLRVDIDGLFIEEST
1057|gene|hla       PDDDEIQPWLDRARRAGVSDDLLERTAGGHTGVVATLSQGEGPCIGLRVDLDAISIHESE
                    *  : :      *   *.    ::   .. **  *    * ** :.:***:*.:   *: 

6600|gene|hbo       DDDHRPAREGFASTHPNEMHACGHDGHTAVGIGIARAF----------------------
4078|gene|nph       ADDHIPAREGFRSET-GAMHACGHDAHMTFGLGVAEAI----------------------
880|gene|hut        DPDHRPVAEGFRPEHDDAMHACGHDAHATIGVGVLEAI----------------------
10659|gene|hma      SVAHAPATEEFRSTNEGYMHACGHDAHATIGLGVLEAV----------------------
1313|gene|hhi       SVAHAPVTEEFRSANEGYMHACGHDAHATIGLGVLEAV----------------------
437|chp|nrc1        ADDHHPAAAGFRSEHDGCMHACGHDGHATIGVGVLAAV----------------------
1411|gene|hla       DADHVPAAERFRSEREGYMHACGHDAHATMGLGALDAV----------------------
2744|gene|hwa       SDEHRPVSEGFRSEMDGHMHACGHDAHAAIGVGVLDAIIETTSPNNKDTQKRKDDVDIDG
18400|gene|hbo      DADHAPAAGGFRSENEGYMHACGHDSHATIGLGVLDAI----------------------
1053|gene|hla       DPDHDPVDEGFRSEIEGTMHACGHDVHMTWGLAVLEAI----------------------
1057|gene|hla       ERDHRPEAEGFRSEHDGYMHACGHDAHLAIALGTLEAV----------------------
                       * *    * .   . ******* * : .:.   *.                      

6600|gene|hbo       ---DAEGFDGTLKLFFQPAEEGGRGGKPMSETTHVDDVDALLALHLGLDEETGTVVGGYD
4078|gene|nph       ---TETDFSGTLKLFFQPAEEVIGGGKPMAESGHLDDVDYLFAVHVGLDYPTGEVVAGID
880|gene|hut        ---ADSDFEGTLKLIFQPAEEVIGGGHAIAESGHLDDIDALLAIHIGLDYPTGEIVAGIE
10659|gene|hma      ---KESDFKGTFKVVFQPAEEVIGGGKAVAESGHLDDVDHLLAIHIGLDHPTGEIVAGVG
1313|gene|hhi       ---KESDFKGTFKVVFQPAEEVIGGGKAVAESGHLDDVDHLLAIHIGLDHPTGEIVAGVG
437|chp|nrc1        ---ADSDFQGTLKVVFQPAEERAGGGKPIAESGHLDDVDYLYAVHLGLDHPTGEVVAGVD
1411|gene|hla       ---LDSDFSGTLKVFFQPGEEQVAGGKPMAESGHLDDVDYLYAVHVGLDHPSGEVVCGVD
2744|gene|hwa       EASGDTEFTGTLKIFFQPGEEQIVGGKPMATSGRLDDIDVLFAVHVGLDHPSGEVVAGID
18400|gene|hbo      ---AESDFEGTLKVFFQPGEEQIAGGKSMAKSGHLDDVDYLLAAHIGLDHPSGEIVAGID
1053|gene|hla       ---ADSDFAGRLVVFFQPAEETGGGGHPMAESAYADDLDYLLAVHVGLDHPIGEVVAGIE
1057|gene|hla       ---KQSAFEGTLKVLFQPAEEISGGGKAMAESGHLDGVDYLFALHVGLDHPTGEIVAGVE
                           * * : :.***.**   **:.:: :   *.:* * * *:***   * :* *  

6600|gene|hbo       RPLSNAKLDVTFEGEPAHAGGAPNEGRNALQAMTTAIQNLYAIPRHADGKTRINVGQVHA
4078|gene|nph       DFLAITQFYTTFEGHPGHAGARPEEGRNAVQAMATAVQNLYGIERHSEGESRVNAGHVGG
880|gene|hut        GMFAVSNFRAEFAGESAHAGGHPDHGHNAVQAMTTAVGNLYAIPRHTDGATRINAGDVGG
10659|gene|hma      GFLAVRQFEATFTGETAHAGGHPAQGRDAVQALATAVQNLHAIRRHGDGATRVNAGVVEG
1313|gene|hhi       GFLAVRQFEATFTGETAHAGGHPAQGRDAVQALATAVQNLHAIRRHGDGATRVNAGVVEG
437|chp|nrc1        GFLAVSHLRADFTGTGAHAGSHPEDGRNAIQAMATAIQNLHAIPRHDGGATRVNAGRAGG
1411|gene|hla       GFLAVRHFLAEFTGEPSHAGARPEQGRNAVQAMAAAVQNLYAIPRHADGPTRVNAGLVGG
2744|gene|hwa       NFLAVSHFEAEFTGIPAHAGARPADGNNAVQAMATAVQNLYAIPRHTDGATRVNAGVVSG
18400|gene|hbo      GFLAVSHFEAEFTGAPAHAGARPEQGDNAIQAMATAIQNLYSIPRHADGATRVNAGVVEG
1053|gene|hla       KPLAMAHLDATIEGTSAHAGKAPNEGDNAMQAMGTAIVNAYGISRHAEGMTRVNVGRAEA
1057|gene|hla       SPLAMAHLTATFEGASAHAGKAPNEGANAMQAAAVAIQNAYGIARHRDGATRVNVGRIEG
                      ::  :: . : *  .***  *  * :*:**  .*: * :.* **  * :*:*.*   .

6600|gene|hbo       DNAQNVICEEAQMRVEVRGEDADLNDYMMQKAERVVEHAAGMHDVAYETSLYGMTTTFEN
4078|gene|nph       GTATNIIPEEAFIHGEVRGETTDVRDYTFERAEQVFEGAAVSHDCTVDIEIEGDAPSAES
880|gene|hut        GSASNVIPESAYIDGEVRGGTTELREYMRERAETVIGAAAEMHDCEASVEWGAQAPSADP
10659|gene|hma      GTATNIVPGEATLEGEVRGETTPLKEYMSERADTVMSSAAEMHDCEVAIETTAEAPSAVS
1313|gene|hhi       GTATNIVPEEATLEGEVRGEMTSLKEYMSERADTVMSSAAEMHDCEVAVETTAEAPSAVS
437|chp|nrc1        GTAPNIVPDSAFLEGEVRGETTALMEYMKSHADRVVRSAAEMHDCTVETATEGQAPSAES
1411|gene|hla       GTATNVIPEESYIEGELRGATTELAEYMSQHADRILESAAEMHDCEVAVSTKGEAPSATS
2744|gene|hwa       GTATNIIPEHAMIKGEVRGETTELMEYTESKATQVLESAATMHNCEVEITTAGRAPSAAS
18400|gene|hbo      GTATNIIPEEASIGGEVRGETTELMEYMEEKSRRVIRSAAEMHACEVAINTEGKAPSATS
1053|gene|hla       GTASNVIAERAQMEAEARGETTALMEFMKSRFERTVRGAATMHGCRASVDVVSESPRADS
1057|gene|hla       GSASNVIAEEVTIDAEVRGETTALMTYARTELERILYAAAELHDCDVTPHVISESPCVDS
                    ..* *::     :  * **  : :  :        .  **  *         . :.    

6600|gene|hbo       DGFVVETVMDAAETVEGVTQICGRSPFGGSEDASFLIRRVQENGGVASYIGIGASNPAGH
4078|gene|nph       DAELVELVTDAARGHPDVERATRRGEIGGSEDATFLMQRVQDTGGLATYACIGTDHPGGH
880|gene|hut        DPELRRLVYDVAGTVDGVASRRERGELGGSEDATYLMRRVQEHGGQATFVGIGTDHPGGH
10659|gene|hma      DDALAGVVYDAADSVPGVTSRLRTDDLGGSEDATYLMDRVQNHGGTATFVGIGTDHPGGH
1313|gene|hhi       DDALAGVVYDAAESVPGVTSRLRTDDLGGSEDATYLMDRVQGRSGTATFVGIGTDHPGGH
437|chp|nrc1        DRELAACFGAVAADRAGVDSVLDSDALGGSEDATYLMRRVQNTGGMACYVCVGTDHPGGH
1411|gene|hla       DDALAGIVGEVAGGVAGVTEIVDRADLGGSEDATYLMQSVQKRGGLACYVGVGTDHPGGH
2744|gene|hwa       DNMLADIVATVAKDADDIDSIIRSDDLGGSEDATFLMRRVQQHGGVAAYIGIGTDHPGGH
18400|gene|hbo      DDELVAIVSDVAKSNASVESVIDRDVLGGSEDATYLMQEVQDNGGLAAYIGVGTDHPGGH
1053|gene|hla       DPELQALVTEVAEGVDGIDTVLPAADFGASEDATFLMKRVQEEGGLATYLIVGTDHPTSH
1057|gene|hla       HPALQEVVGNVAWGVDGVEHVIPSEEFGVSEDGTYLMQQVQDAGGLASYVLVGTDHPTSH
                       :   .  .*    .:        :* ***.::*:  **  .* * :  :*:.:* .*

6600|gene|hbo       HTAYFDIDEAALDIAVGVVEEAVRRLAVRL----------------
4078|gene|nph       HTATFDVDEASLSLGVDVLADAIAATAETMP---------------
880|gene|hut        HTATFDVDETSIGIGVDVLTDAILAIGEQKA---------------
10659|gene|hma      HTPLFDIDEDSLTIGIDVVTEAISQLSG------------------
1313|gene|hhi       HTPTFDVDENSLAIGIDVVSKAISQLSE------------------
437|chp|nrc1        HTPTFDVDEQSLRIGVGALTTAITRVAETRP---------------
1411|gene|hla       HTSTFDVVEGDIAVGIDVLAGAIRKVAETRP---------------
2744|gene|hwa       HTDTFDVDEASIGHGVEILTNSIITAENKLQKSE------------
18400|gene|hbo      HTRTFDVDEDSIGIGVEVLAGAILDVAEMRP---------------
1053|gene|hla       HTPTFDVDERSIRHGVDVLVGAIRDLEQRHPVPQVEDEAAIRSEQD
1057|gene|hla       HTPTFDIDEESLAIGVNILSETFVELSRRRP---------------
                    **  **: *  :  .:  :  :.