HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0317arCOG04726hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0317 nrc1 VNG2204 vng2204 no entry
tucHOG0317 hmu HMUK0912 Hmuk_0912 conserved hypothetical protein
tucHOG0317 hma RRNAC2629 hypothetical protein
tucHOG0317 hwa HQ3649A hypothetical protein
tucHOG0317 hla HLAC1670 Hlac_1670 hypothetical protein
tucHOG0317 hbo HBOR29560 Hbor_29560 hypothetical protein
tucHOG0317 hut HUTA1543 Huta_1543 conserved hypothetical protein
tucHOG0317 hvo HVO_0234 HVO_0234 conserved hypothetical protein
tucHOG0317 nph NP5160A hypothetical protein
tucHOG0317 hhi 3047 HAH_3047 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2204|hp|nrc1      ------------------------MPAIRDDHVFVEDTDAHVAYIAAGLGITAAHIGAST
3649|hp|hwa       ------------------------MPTIDEKRVYTNTVGTETVYLGSELGVLGVTVSDAV
1670|hp|hla       ------------------MAPAEDDISIEEKRVYAGTAGRTDAYVATESGVVRVALSADK
1543|chp|hut      ------------------------MGEMAEDRIYADRRGKADVYVGSPLGLTLVAVSDDR
12629|hp|hma      MPTQVKTLRMRSKHTKRRYEVSDDDIALSEKRMYGAKRPETHAYVASGLGVTRVETAGGQ
3047|hp|hhi       --------------------MSDDDIALSEKRMYGAKRPETHAYVASGLGVTRVETAGGQ
5160|hp|nph       --------------------MSDEDISIHEKRVYADKSATTTALVASSVGVTEVKISDDI
29560|hp|hbo      ------------------------MPTIDEKRVYTDNTGTETVFVASDAGVVAVSVSDDL
                                             : :..::        . :.:  *:  .  .   

2204|hp|nrc1      VGEFALEHRCDARDVAA-----TRLGVAAATADGVVLSTA-----PPDSS--FADI----
3649|hp|hwa       VGEFGLAYRGAVRDITT-----AGPYVATATDDGVLLADHRRRREDAGDEASIDELQFYN
1670|hp|hla       IGAFDMVAREPARDAAVLPRRDAPDLLGVATPDGLQVAPV-----GDDLA--FEPV----
1543|chp|hut      VGRFRLLRRGAVRDVAT-----GDGSILIGTDEDIYR--------STDGGDSFDAA----
12629|hp|hma      IGRFSLSERCNARDVAG-----ASGEVAVATDEDVLV--------LTDDG--FVPT----
3047|hp|hhi       IGRFSLSERCNARDVAG-----ASGEVAVATDEDVLV--------LTDDG--FVPT----
5160|hp|nph       VGEFSLAHRCQARDVAT-----GNGRAAVATEADVLV--------GVDGE--FVDT----
29560|hp|hbo      VGGFGIAHRCHARDVAV-----GTETLAVATDEDVFCADLTTTDSADDLA--FEAT----
                  :* * :  *  .** :             .*  .:            .    :       

2204|hp|nrc1      ---GFPAA----VAVTGF------DGTVLAADEDGRIAQYDPDAGA-----------W--
3649|hp|hwa       IGDGIGSV-----SAVGFETTTQNKVALIAGETSGDIYRLTMSPDDVFGSQPEIPSTW--
1670|hp|hla       ---DVDPVGSKSLVAVGVH----DDAFLVAGE-DGEINGIEFGDEE-----------SDP
1543|chp|hut      ---GFGPA-----VAVGFD----GDPIAADPD--GAVARFAVAADE-----------W--
12629|hp|hma      ---GFGPA-----TAVGYD----GDGLLAAGD--SRVARY---TGE-----------W--
3047|hp|hhi       ---GFGPA-----TAVGYD----GDGLLAAGD--GRVARY---SGE-----------W--
5160|hp|nph       ---GFGPA-----SAVGY-----GDGLVAAGG--GRIARYD--GDD-----------W--
29560|hp|hbo      ---EFGPA-----TAVGFD----GKTLL-AGDEEGRVGRF---DSE-----------W--
                      . ..      ..*       .         . :                       

2204|hp|nrc1      TDRAVLTDATVRALDADLVAATDGVHRLTDA---G--LADAGLDDAYDVSAPGVPHAATS
3649|hp|hwa       --NFIDTCSTVYEIDMPLIATAEGVFQVTSDAPSGTVISYAGLDTAHDIDAE--PVAATT
1670|hp|hla       TATSIGTVSDPRAVDGPLVAAADGVYRVSGD---GSELVSVGLDDARDVAGSGMPLAATA
1543|chp|hut      --QHLGSVDGARAIDGAWLAADDGVYRIGEG---G--LEHAGLQTARDVAAGGAVLAATA
12629|hp|hma      --QGIGEVADVQAIDGDRLAAAEGVYALPS-------LDRLGLVDVADVSGD---YAATE
3047|hp|hhi       --RDIGEVADVRAIDGDRLAAAEGVYALPS-------LDRLGLVDVVDVAGD---YAATE
5160|hp|nph       --EQLSTVENVRAIDGDFAAAAGGVYRLDG--------THVGLDDAYDVVGGAEPLAATG
29560|hp|hbo      --TDLGRAEPVRAIDGPLVAAADGVHRVEADS-----LAPVGLDNAYDVVGR-DPLAATE
                      :        :*    *:  **. :             **  . *: .     *** 

2204|hp|nrc1      EGLFALG------NG-WREAATGAFRTV-----AADPASAAPGATGVAHAATPEACFEHR
3649|hp|hwa       DGLYVLA------NG-WIKIPSIEQAESVDIMRSSD-------RLVRAHAVCGGSLYACN
1670|hp|hla       AGVYWLG------NG-WMTALEGDATAV-----AAD-------GDGHAMAVVDGDLFVHA
1543|chp|hut      DGIHRYV------DGEWTTERSVDVRAV-----ASD-------GTRAHAVGPDG-LYEYD
12629|hp|hma      SGLYRYG----GENGEWTEVRSGRHVAV-----ASD-------GEQVHAAAADG-LYELT
3047|hp|hhi       SGLYRYESGSTDSDGEWTEVRSGRHLAV-----ASD-------GEQVHAAAADG-LYELT
5160|hp|nph       SGLYYLA------NG-WMEAADGSFHAV-----AGG-------SSTAAHAVGDGTLFEQN
29560|hp|hbo      TGLYKLG------NG-WMDVLNGAFETV-----TAD-------GDGRAHAVGGGHLFARS
                   *:.         :* *                :..             .      :   

2204|hp|nrc1      ----------TDA-WQPCRDIAPSDAARVVDATYAVDTTILLTAAGTL-IVVDGDGD---
3649|hp|hwa       VSNTAGLVPDMGAHWKSVN--LPVT-EPIMAVTHSHTTTYAVTTDGTLAACVDITTETAE
1670|hp|hla       DDDTE---WDAGA-WTAAD--LPVD-EVPVALGYGPGVSVAVTDAGTL--CVDA-GD---
1543|chp|hut      -----------GT-WGRRE--SPID-EPIVDVGYA-GGIVAVTDAGTI--LVDPAAS--K
12629|hp|hma      ----------DGS-WEPCT--LPVD-ERVVDVTHG-DDTYAITENGTF--LVATAAEATA
3047|hp|hhi       ----------AGA-WEPCT--LPAT-ERVVDVTYG-DDTYAITENGTF--LVATAAEATA
5160|hp|nph       -----------EE-WTAVE--LPTE-ESVVDVAHG-DGAYAVTETGTV---LATVGD---
29560|hp|hbo      ---------ESGE-WTPEP--VPVA-EGVAAVTYGPEATYAVTTPGTF--LVRLPGS---
                                *       *          :.      :*  **.   :    .   

2204|hp|nrc1      -------------ARHRSLGLPDAAAVTVVGHTPDR
3649|hp|hwa       TTKKKPAHRREAEWQHRSLGVTGVSAIAVSDNNW--
1670|hp|hla       ------------GWRHQVVGVRGVAGVALAVVE---
1543|chp|hut      DG--------AEGWRTRSLGLEDVSGLAVADQ----
12629|hp|hma      DG--------QGGWRQRSLGVPDVVGVAVA------
3047|hp|hhi       DG--------QGGWRQRSLGVPDVVGVAVA------
5160|hp|nph       ------------GWRHRALGLPDVSGLAVL------
29560|hp|hbo      ------------EWRHQMLGLQGVTAAAVV------
                                . . :*: .. . ::