HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0316COG0135KOG4202arCOG01983Phosphoribosylanthranilate isomerasephosphoribosylanthranilate isomerase

HOG Organism Gene ID Name Annotation
cHOG0316 nrc1 VNG1648 trpF phosphoribosylanthranilate isomerase
cHOG0316 hmu HMUK1770 Hmuk_1770 Phosphoribosylanthranilate isomerase( EC:5.3.1.24 )
cHOG0316 hma RRNAC1519 trpF N-(5'-phosphoribosyl)anthranilate isomerase
cHOG0316 hwa HQ3168A trpF phosphoribosylanthranilate isomerase
cHOG0316 hla HLAC1940 Hlac_1940 N-(5'phosphoribosyl)anthranilate isomerase (PRAI)
cHOG0316 hbo HBOR10780 Hbor_10780 phosphoribosylanthranilate isomerase( EC:5.3.1.24 )
cHOG0316 hut HUTA1282 Huta_1282 Phosphoribosylanthranilate isomerase
cHOG0316 hvo HVO_2455 HVO_2455 trpF N-(5'phosphoribosyl)anthranilate isomerase
cHOG0316 nph NP3340A trpF phosphoribosylanthranilate isomerase
cHOG0316 hhi 2090 trpF N-(5'-phosphoribosyl)anthranilate isomerase
MUSCLE (3.6) multiple sequence alignment


10780|gene|hbo      ---MVRVKICGVTSESDLRAVERAGADAVGFIADVPVDTPRELSLDRAAELAAAAAPFLT
3168|gene|hwa       MMSRTRVKICGITTKNDLAAVSAAGADAAGIITDVTVETPRSVTVERATQLVATASPFLS
3340|gene|nph       ---MTRVKVCGITNRSDLDTAVDAGVDAVGLIVDVDVQTPREISPQQAAELAAATPPFVT
1648|gene|nrc1      ---MTRVKVCGLTTERDHAAAVAAGADAVGIIADVPVETPREVSVETATALRAATPPFVT
1940|gene|hla       ---MARVKICGLTRGADLRAAIDAGADAVGVISEVPVDSPREVDPATAAELLADVPPFVT
1282|gene|hut       ---MTRVKVCGHTREADVRASVAAGADAVGVISGVPVETPREVAPERAADLLDAVPPLVS
11519|gene|hma      ---MTRVKICGVTDTEDRDAVVTAGADAVGIIHGVPVDTPREVDEGTAETIADGVPPFVT
2090|gene|hhi       ---MTRVKICGVTDNKDRDAVIAAGADAVGVIHGVPVDTPREVDEKTATTLVDGVPPFVT
                        .***:** *   *  :   **.**.*.*  * *::**.:    *  :   ..*:::

10780|gene|hbo      TTLVTMPETVSEAIEVGSRVKPDVVQIHGEFDAEQFRAIRAGVDARIAAVVDAEQPQRAC
3168|gene|hwa       TVLVTMPNCVADAIDITGRVQPDVIQIHGEYDASELKQINESVTADVIAVVDAEMPSRAR
3340|gene|nph       AVLVTMADVPDAATELVEAVRPDAVQVHGESTPDALASLGAAVEADVIKATD---PGTAA
1648|gene|nrc1      SVLVTMPATPEHAVDLVRTVAPDAVQLHGDLPVGDAAYVAANTPCPVIKAVTAGDQS-AA
1940|gene|hla       ATLVTMPDSAERAVELLRTICPDAIQLHGEWTPDEIRFIRAETERKVLLAVDADDPARAE
1282|gene|hut       GVLVTMPETVEEARELVAETQPDAVQVHGTLDPEEVEALTAEISQPILVALDHDAE--LD
11519|gene|hma      SVLVMMPTTVQEAVRRIDRIEPDAVQVHDGLSPAELGALNNRITQDIVAVVEADAPA-IE
2090|gene|hhi       SVLVTMPTTVQEAVRRIDRVEPDAVQVHDGLSPAELGALASRITQDIVSVVEADAPA-IE
                     .** *.     *        **.:*:*.         :       :  .          

10780|gene|hbo      DLDSAVDAIVVDS--VSDKGA-GGTGKTHDWEQTAKATAELDAPVVLAGGLTPENVTEAV
3168|gene|hwa       SVASVVDAILIDS--VDTDGA-GGTGHTHDWTTTAEIATMLDSPVILAGGLTPSNVKSAV
3340|gene|nph       TYDGHADAVLVDS--LDESGA-GGTGTVHDWDRTGELVESLQSPVVLAGGLTPENVADAV
1648|gene|nrc1      RYADVVDALLVDSPPTDDAGAGGGTGRTHDWAATRAFADRVDTPVVLAGGLTPANVADAV
1940|gene|hla       EFDRVADALVIDS--TDDSGA-GGTGETHDWERAGDLADRLTSPVVLAGGLTADNVAEAV
1282|gene|hut       AYADAADGLVVDS--LDEAGG-GGTGQTHDWDRTAEIVERLDVPILLAGGLTPENVAEAV
11519|gene|hma      DYATHADALLVDS--VDADGG-GGTGETHDWERTRDLVDSLDVPIVLAGGLTPENVTEAV
2090|gene|hhi       DYADHADALLVDS--VDADGG-GGTGETHDWERTRDLVDSLDVPVVLAGGLTPENVAEAV
                         .*.:::**   .  *. **** .***  :   .  :  *::******. ** .**

10780|gene|hbo      ETVNPFAVDVASGVESSGGVKDHDAVRAFVANAAE-------------------------
3168|gene|hwa       QTVAPFGVDVASGVEDTGGSKDHDAVAAFINRATRVDIDTNNETERSIETTNTTDSSTED
3340|gene|nph       EAAAPFAVDVASGVEAESGQKDADAVSAFVDAAGG-------------------------
1648|gene|nrc1      DTVDPFAVDVASGVEARPGEKDHAAVSAFVARATA-------------------------
1940|gene|hla       RAADPFAVDVASGVELTDGRKDHNAVARFVANAGR-------------------------
1282|gene|hut       ETVRPFGVDTASGVERDGGVKDHDAVEQFVDRAGE-------------------------
11519|gene|hma      ETVEPFAVDVASGVESAGGTKDHDAVGRFVRNAKQ-------------------------
2090|gene|hhi       EAVDPFAVDVASGVESSGGTKDHDAVERFVRNATR-------------------------
                     :. **.**.*****   * **  **  *:  *                           

10780|gene|hbo      -----RRRATA-
3168|gene|hwa       SISATTPERNK-
3340|gene|nph       -----CQ-----
1648|gene|nrc1      -----TPDPTLT
1940|gene|hla       -----EMELA--
1282|gene|hut       ------PRVVA-
11519|gene|hma      -----APEGAV-
2090|gene|hhi       -----ASEGTV-