HOG Organism Gene ID Name Annotation
aHOG3140 hbo HBOR06270 Hbor_06270 methylase involved in ubiquinone/menaquinone biosynthesis
aHOG3140 hma Hma_10720 ubiE3 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


6270|gene|hbo      MGDTLEYDEKEARQEAAIYRTQAAADRRELVRETLDLQRGDRVLSIGCGPGFEPAELAGA
10720|hp|hma       MGGTLDYDEAEARQEEAIYRTPAAAARRERVRGLLAPEPGDTVLSIGCGPGFEPAEIGWA
                   **.**:*** ***** ***** *** *** **  *  : ** **************:. *

6270|gene|hbo      VGESGYVHGIDRSEAMLTLANQRCDDLPQAALSKGNALDLPVADESFDAAVAVQVFEYLD
10720|hp|hma       VGNEGHVHGIDRSQAMLELARERCASLPQVTVSQGDAGDLPVADESVDAAVAVQVFEYLE
                   **:.*:*******:*** **.:** .***.::*:*:* ********.************:

6270|gene|hbo      RVDAAVNELARVLRPGGRAVVCDADFDSLVWRSPNPARMERVLDAFDDHCPWPHLGSRLA
10720|hp|hma       TVSSAVAELARVLRPGGSAVVCDADFASLVWRSPNPERMARVLRAFDDHCPQPRLGSRLA
                    *.:** ********** ******** ********* ** *** *******.*.******

6270|gene|hbo      PLLRDAGLTIERVEPNTMLETRLNDESFAYHLMEFIKDYAANHDSIGSDEASAWVADLRE
10720|hp|hma       PVLREAGLTVDRVEPNTIVNTRLEEETFAYHLMQFIEDYAADHGAIGRMAAQAWANDLRE
                   *:**:****::******:::***::*:******:**:****:*.:**   *.**. ****

6270|gene|hbo      HEENGATFFNFTQYLYRVRK--SK
10720|hp|hma       QEVAGETFFSFTQYCYFVRKPVSR
                   :*  * ***.**** * ***  *.