HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0314COG1599KOG0851arCOG01510Single-stranded DNA-binding replication protein A (RPA) large (70 kD) subunit and related ssDNA-binding proteinsreplication factor A related protein - rpa41

HOG Organism Gene ID Name Annotation
cHOG0314 nrc1 VNG1255 rfa2 replication factor A related protein - rpa41
cHOG0314 hmu HMUK2418 Hmuk_2418 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0314 hma RRNAC1133 rpaA replication factor A
cHOG0314 hwa HQ2405A rpa replication factor A
cHOG0314 hla HLAC0623 Hlac_623 replication factor A
cHOG0314 hbo HBOR18970 Hbor_18970 single-stranded DNA-binding protein
cHOG0314 hut HUTA0544 Huta_0544 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0314 hvo HVO_1338 HVO_1338 replication protein A
cHOG0314 nph NP3960A replication factor A
cHOG0314 hhi 1740 rpaA2 replication factor A
cHOG0314 hhi 4146 HAH_4146 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4146|hp|hhi         ------------------------------------------------------------
623|gene|hla        -------------------------------------MDVNSHAEELASDLGVDKEEVKA
2405|gene|hwa       -------------------------------------MDVDDHAEELASTLGVDKTEVKS
18970|gene|hbo      -------------------------------------MNVDEHAEELASTLGVDKSEVKS
3960|gene|nph       -------------------------------------MSLDDAAEDLASSLGVDKAEVKE
1255|chp|nrc1       MHTVAVSGPPETGFRSVVCARRWLANPYAPGRPTVRCMNVDDHAEELASDLGVDKAEVKE
544|gene|hut        -------------------------------------MSVEDKAEELASDLGVDKAEVKE
11133|gene|hma      -------------------------------------MSLEDHAEELASDLGVDKEEVTR
1740|gene|hhi       -----------------------------MLPSNRQSMSLEDHAEELASDLGVDKEEVTR
                                                                                

4146|hp|hhi         -------MTEPTSKARDGSATNSSESPVDEQPIPVV--KPPSAFVWQDEVVPALDGAITV
623|gene|hla        DLQNLLEYSVPIDEAKQSVRRKHGGGGGGSTPTPDS--VDVDEITTDHDGVTVTVRVLTQ
2405|gene|hwa       DLENLVAYSVPVDEAVQSIRRKYGSDTGNAA-VPST--KDVDAVDIDDGNVTVTVRVITV
18970|gene|hbo      DLEDLLSYSVPIDEAKQSIRRKHGGDSGEST-APTA--KGVSDITPEDGNVTVTVKVLTV
3960|gene|nph       DLEKLVSYSVPMDEAKQSLRRKYGDEGSTGGGADDAPTTDIEEITTDDDRVTVTARVLTV
1255|chp|nrc1       NLQNLVEYSVPLEEAKRSLRRKYGDDDGAPSGGPTA--VDIADVDTDSGNVTVTATVLTA
544|gene|hut        DLQNLVSYSVPLEEAVQSLRRKYGDTDDSGGSIPEA---DVAEVSTGDDAVSVTGVFLTV
11133|gene|hma      DLENLVNYSVPMDEAKQSLRRKYGDGSSGGDSTPSS--KAINEVSTEDSNVTVTAVVLTS
1740|gene|hhi       DLENLVNYSVPMDEAKQSLRRKYGDGGSSGDGTPSS--KAISEVSTDDSNVTVTAVVLTS
                            : * .:*  .   : .                   .      *..    :* 

4146|hp|hhi         RPESARYPIAAQVVDGAEYLVATARETFTPPADYQ-------------------------
623|gene|hla        GTRTIRYQGDDLTIREGEIADETGVISYTAWQDFG--FEPGDSLTMGNAGVREWEGEPEL
2405|gene|hwa       GCRTIQYQGDEQVIREGILADETGTISYTAWQDFG--FEPGDSVTIGNAGVREWDGQPEL
18970|gene|hbo      GRRSIRYQGEEQTIREGEFADATGKISYTSWEDFG--FEPGDSVTIGNANVREWEGEPEL
3960|gene|nph       GKRSIRYDGDDQTIFEGELADGTGRISYTAWTDFS--LTPGDTVTVGNAGVREWDGNPEL
1255|chp|nrc1       GKRSIRYQGDDHVIGEGELADETGRISYTAWEEFG--LEPGDTVTIGNASVREWEGSPEL
544|gene|hut        GTRSIRYQGSDHVIHEGEFADETGKISYTAWEDFG--VEPGDVVRIENAGVREWDGEPEL
11133|gene|hma      GRRSIQYNGEQHVIREGELADETGKISYTAWDGFSGDLQPGQTVQLGNAGVREWDGQPEL
1740|gene|hhi       GRRSIQYNGEQHVIREGQLADETGKISYTAWDGFSGDLQPGQTVRLGNAGVREWDGQPEL
                       : .*     .:  .     *.  ::*.   :                          

4146|hp|hhi         ------------------------------------------------------------
623|gene|hla        NLNDSTTVAIADETV-----EVDQEVGGDRSLVDIAAGDRGRNVEVRVLEVDEKTISGRD
2405|gene|hwa       NIGQSSTVAVETDSISVVEHDLPCPIGGHTSLLELRPGNRGRVVDVEIIEIEERVIDGRD
18970|gene|hbo      NLGQSSTVAVETTPV-----ETPYEAGGDTDLVDLRAGDRGRNVEVQILESEERVISGRE
3960|gene|nph       NLGQSTTVTLEEEPL-----SVPYDVGGQRNLIDLEPGDRGRTVEVRVLEVEQKTIDGRD
1255|chp|nrc1       NFGESATVTSADGDI-----EMAAEVGGDRDLAALSAGDRGRNVEAVVTEVEERTIDGRD
544|gene|hut        NLGERTTVRLSDDAI-----DVPYDIGGDRRLAALAPGDRGVNAEVQVLEREQKIIDGRD
11133|gene|hma      NLGDSTDPEVVDETL-----DIDYDVGGRAALQDLAPGDRGITVEVQVLECEQKVIDGRD
1740|gene|hhi       NLGDSTDPEVVDETL-----DIDYEVGGRAALQDLAPGDRGITVEVQVLECEQKVIDGRD
                                                                                

4146|hp|hhi         ------------------FQSWGP---LQSG-----------------------------
623|gene|hla        GETEILEGVVGDATAKLPFTDWQPRSELEPGADLRIEDVYVREFRGVPSINLTEFSTVTP
2405|gene|hwa       GETTIHSGVIADGSGRLPFTDWGARSILSSGETYRFDDVYIREFRGAPQVNLSTFTTVES
18970|gene|hbo      GDTTIRSGVVADETGRLPFTDWGARPELREGETFRFEDVYVREFRGVPQVNLSEFTTVTP
3960|gene|nph       GETEILDGVFGDETSRLPFTDWDPHDAIEAGTSVRLEDVYVDEFRGVPSVNVTAFTTVEA
1255|chp|nrc1       GETEILSGVLGDETARLPFTDWDPHGEIEAGASVRIEDVYVREFRGVPSVNVSEFSTVER
544|gene|hut        GETEILSGVLADETARLPFTDWDPHAGIEEGASIRIEDAFVREFRGAPAINVSEFSTVTA
11133|gene|hma      GETTILSGVLGDESGRLPFTDWDPHDEIEEGASVRLDETFVREFRGAPSVNVSEFSAVTA
1740|gene|hhi       GETTILSGVLGDESGRLPFTDWEPHDEIEEGASVRLDETFVREFRGAPSVNVSEFSTVTA
                                      * .* .   :  *                             

4146|hp|hhi         ------------RLALRS---------------------GEPQFPPA-DVSRAI------
623|gene|hla        LPDPVEVAEDAPRLSVADAVASGGMFDVEIVGNVLEIRDGSGLIERCPECGRVVQNGQCR
2405|gene|hwa       LSEDIEITDDAKQVEIGEAVDSGGVFDVEIIATVLEVREGSGLIERCPECNRALQGGQCR
18970|gene|hbo      LARDVPVNDEAPRMRIGEAVASGGMFDVEVVGNLLEVRDGSGLIERCPDCGRVLQNGQCR
3960|gene|nph       IP-EVAVSDEATAMSVQEAVDAGGVYDVELTGNIIEVRDGSGLIQRCPECGRVVQNDQCR
1255|chp|nrc1       LDHEVEV-GGPTRMAIRDAVARGGAYDVELVGSVIDIRDGSGLIKRCPDCGRVVQTGQCR
544|gene|hut        LDRTVEATDDAPRMAIREAVEGGGLFDVEVTGTAIAVRDGSGLIERCPECGRVVQNGQCR
11133|gene|hma      LDRTVGVTEDAPRLSVREAVESGGLFDVELAGNVIEVRDGSGLIERCPECGRVIQNGQCR
1740|gene|hhi       LDRTVEVTEDAPRMSIREAVESGGLFDVELAGNVIEVRDGSGLIERCPECGRVIQNGQCR
                                 : : .                     *.  :  . : .*.:      

4146|hp|hhi         ------------------------------------------------------------
623|gene|hla        SHGDVDGEDDLRVKAIVDDGTDTVTVVLDDELTAEVYGGGLDDALDAAKDAMDKEVVAEA
2405|gene|hwa       EHGAVEAKNDMRVKAIVDDGTGAVTAILDRELTESVYGGSMDEAMSVAREAMDKSVIAEE
18970|gene|hbo      THGDVDGEDDMRVKAILDDGSGTVTAVLGRELTEQLYGGTMAEAMEAAREAMDKEVVADE
3960|gene|nph       SHGKVDPEDDLRVKAILDDGTDSVTVILGRELTEEVYGGTLTDALEAARDEMDRGVVADD
1255|chp|nrc1       QHGAVEAEDDLRVKAVLDDGTDSVTAILDRELTADVYGGTLADAREQAREAMDHSVVADT
544|gene|hut        SHGAVEGEDDLRTKAILDDGTGTVTAVLDEELTAEVYGGGLEDARDHARDAMDRDVVTDA
11133|gene|hma      SHGAVEGEDDLRTKAILDDGTDTVTAVLDDELTARVYGGDLDDAREHARDAMDKEVVAER
1740|gene|hhi       SHGAVEGEDDLRTKAILDDGTDTVTAVLDDELTARVYGGDLDDAREHARDAMDKEVVAER
                                                                                

4146|hp|hhi         ---------------------------ATLAKHPAYQPERFTIFY-----
623|gene|hla        IADSLVGHAYRVRGNLSVDDYGANLDASEFALADDDPADAARAALAEVGE
2405|gene|hwa       IRSTIVGREYRIRGNLSVDEYGANLETAEFEQTSDDPATRAQSVLEEVTS
18970|gene|hbo      IRRQVVGREFRVRGNLSVDDYGANLEATEFAESEDDPTERATALLGEVTA
3960|gene|nph       IAETLAGREYRVRGSLSVDEYGANLDATDFEESGGDPASRAERFLAEVGR
1255|chp|nrc1       IAEDVVGREFRVRGHLSVDEYGANLETIAFAERDDDPAARAAAFLAEVDA
544|gene|hut        IREAIVGRAFRVRGSLSVDDFGATLNATEFESRRDDPAARAREVLAEVEP
11133|gene|hma      ISDRIVGREYVVRGSLSVDEYGANLTASTFAEADDDPATRAQALLQEADT
1740|gene|hhi       ISDRIVGREYVVRGSLSVDEYGANLTASTFTEADDDPATRAQALLQEADA
                                                 :       .