HOG Organism Gene ID Name Annotation
aHOG3139 hbo HBOR37840 Hbor_37840 hypothetical protein
aHOG3139 hbo HBOR37850 Hbor_37850 hypothetical protein
aHOG3139 hma Hma_3051 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


37840|hp|hbo      MSTQNPTDTTETKRKEEILAEFPDPHTTSKQYTGDQRCHDDFWDIKRAFGIPKMEWDATY
3051|hp|hma       MRMTDPMAA--------------DGHHALKWLASDDG------SVDRSF-----------
37850|hp|hbo      -----------------------MSSDTDREIASTSR-----------------------
                                             : .  :. .                        

37840|hp|hbo      TEEEAEGKAYAEAGERKLRKKLLPNIIFHDWDPDDHQLSVGGTDWLAVGPPGSGKSNLAL
3051|hp|hma       ----AAGLDSLRAQQRHLQQSL----------RDGFQTRTEVLEWCHAVDVVSGGQTPET
37850|hp|hbo      -----PALSKLEADHDDLVTRL----------RDGFESSEDLLFWLQEVSVATLGCFPDE
                        .     *    *   *           *..:       *       :       

37840|hp|hbo      WLAVRLMEANNEKVIWRASTSRSEWLPFAPWARVCLPKGVDIEARFVPKDPTQEGFEVDL
3051|hp|hma       WHEDLVKDR---------------------WEVACLMAETDDRIAICDQAPRDD------
37850|hp|hbo      DLTDAFVESN---------------------SKACLIVGPDRHNTLLD-EPTDL------
                       . :                         .**    *    :    * :       

37840|hp|hbo      EEIVREVVRYRDPVHLNHDLLKPGQFHVVYPDPKMRRLQEIYENDQEKQYDGLEFSEDDP
3051|hp|hma       ----ETADAFR--RRLIRKVLLPA-FQDATEMLR-ERVGEFSDEEGVKDAERIQYVAGRP
37850|hp|hbo      ----QTAKRFR--LGFEETFLLPA-FRQSYRKLR-KNANEY-----VRPEDRPVTRATDP
                        .  :*    :   .* *. *.      .  .  *       .  :        *

37840|hp|hbo      LNHWWFGWMHARIAEGPHHWSSIMFDEIGDIAPEAARNDEYAHYQKVELLKDCWVDARKY
3051|hp|hma       R-------LHQRAVEQHGMLRRTLRDPPG---VES------------EVMA--WAE----
37850|hp|hbo      VA------LRPALEELHERQRETIEDVLGGFEDEE------------ELLD--WVR----
                          :.    *        : *  *    *             *::   *.     

37840|hp|hbo      GHSIFAFGHSEADIHS--MIRRKIRWRVTMNGTAN--PTNSGDVVG-FRRVPMEDDIMSS
3051|hp|hma       DIIHMTEGHVRSGFIEDVLDRHGNWWHSLTRGPSV--RLE------W----LLAGEIFPA
37850|hp|hbo      GLIGASYGQIDRDVITGLRMSDRVSRDNLLSDPSMEYSLNDGKGSAWFRKSLVAVQLLPA
                  .    : *:   ..           .     ..:     :            :  :::.:

37840|hp|hbo      RDVGMFMPFSESEFQYPPVKAAHIPSPIDMTLKVSYA
3051|hp|hma       MNATLSELVTNSN-ELADVAGRAKEVPPG--------
37850|hp|hbo      FNAGVRKLVDRAG-EETSEEEEDENGDVGDHISV---
                   :. :   .  :  : .           .