HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0313arCOG01643hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0313 nrc1 VNG2157 vng2157 no entry
nucHOG0313 hmu HMUK1021 Hmuk_1021 deoxyribonuclease/rho motif-related TRAM
nucHOG0313 hma RRNAC2740 TRAM domain-containing protein
nucHOG0313 hwa HQ3259A hypothetical protein
nucHOG0313 hla HLAC2542 Hlac_2542 deoxyribonuclease/rho motif-related TRAM
nucHOG0313 hbo HBOR28750 Hbor_28750 SAM-dependent methyltransferase, tRNA(uracil-5)- methyltransferase-like
nucHOG0313 hut HUTA1622 Huta_1622 deoxyribonuclease/rho motif-related TRAM
nucHOG0313 hvo HVO_0298 HVO_0298 tram domain protein
nucHOG0313 nph NP1298A hypothetical protein
nucHOG0313 hhi 27 HAH_0027 TRAM domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2157|chp|nrc1       MLLERPPPVGSMADCPIADECPSFQEQIEGMGCQHYGDRGGMEWCQHYSQPIEDLQTAPV
3259|hp|hwa         -----------MSECPLADDCPRYSERISGMGCQYYGDRGGAEWCSSYDQPIQDLKAQPV
28750|gene|hbo      -----------MSDCPLANDCPRYSERINGMGCQYYGDRAGSEWCNSYEQPIRDLKQQPV
2542|gene|hla       -----------MADCPLADDCPSFDERIEGMGCQHYGNKGGAEWCNHYDMPIYELKQQPV
1298|hp|nph         -----------MPDCPLADDCPSFSERIEGMGCQHYGDRGGAEWCSHYSQPINDLKQQPV
1622|gene|hut       -----------MADCPLADDCPEFTERIEGMGCTHYGDRGGAEWCNHYNQPISDLKSQPV
12740|gene|hma      -----------MADCPLADDCPEFTERIQGMGCTHYGDRGGAEWCNHYNQPISELKSQPV
27|gene|hhi         -----------MADCPLADDCPKFTERIQGMGCTHYGDRGGAEWCNHYNQPISELKSQPV
                               *.:**:*::** : *.*.**** :**:..* ***. *. ** :*:  **

2157|chp|nrc1       VPGEEVVIEVDDMHESGAGVGRQEESGFIVMVDGVLPPARVKAEVSTVKPNYARAEL-IE
3259|hp|hwa         KPGEEVVVDVDDIHESGAGVGRTDD-GFIVLIDGLLPTSRAIVRIDRVKSNHATAKKIVE
28750|gene|hbo      KPSEDVVVTVDDIHESGAGVGRTED-GFIVLVDGLLPEARAVVRIDQVKSNHARSKKVVE
2542|gene|hla       QPGEEIVVEVDDIHESGAGVGRTDD-GFIVLVDGLLPPARAEVRIHRVKSSHATAQDVVE
1298|hp|nph         QVGEEVVVDVGDIHESGAGVGRTED-GFIVMVDGVLPEARAKVRITEVRSNHARADE-VE
1622|gene|hut       QPGEEVVVTVEDIHESGAGVGRTED-GFILLIDGVLPEARAKVRVTTVHSNHARAEE-VE
12740|gene|hma      KMGEEVTVDVEDIHESGAGVGRTED-GFIIMVDGVLPPARSLVKVTNVHSNHARAEE-VE
27|gene|hhi         KMGEEVAVDVEDIHESGAGVGRTED-GFIIMVDGVLPPARSLVKVTNVHSNHARAEE-VE
                      .*::.: * *:********* :: ***:::**:** :*  . :  *...:* :.  :*

2157|chp|nrc1       KLPDEPADADDDDAAGGDDEDADDGGHDD----------------RER-LGSRDNFWGS
3259|hp|hwa         RLPVDDDSETADETDSTAGHDDESTTDND-------SEINNSGSDQSTALGSRDNFWGG
28750|gene|hbo      RLPLDPDEVEDEAAGTSDTDEESGEESDD------------DGPKRPTALGSRDNFWGS
2542|gene|hla       RLPDDPEEGEGDDGDGDDPAGDDVDDADDTEEDDGKGDRRRDRPDRER-LGSRENFWGK
1298|hp|nph         RLPLEEDEDGSSEPDTTDDSDPGAEEADD-------RSDRERALDREE-LGSRENFWGN
1622|gene|hut       RLELDPEESEGEDGDEAGESS-DEESSDD-------GDGRDDGPDRPE-LGSRDNFWGS
12740|gene|hma      RLEMDEDPSESETEENDADADETDDNADD----------------DGRRLGSRDNFWGS
27|gene|hhi         RLEMDEELSESETSESDTDTDETDDDPDD----------------DGRRLGSRDNFWGS
                    .*  :      .               :*                    ****:****