HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0312COG0457KOG4162 KOG0495 KOG0551 KOG0553 KOG1124 KOG1126 KOG1155 KOG1156 KOG1173 KOG1258 KOG2002 KOG2076arCOG03032FOG: TPR repeathypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0312 nrc1 VNG2468 vng2468 no entry
cHOG0312 hmu HMUK1240 Hmuk_1240 Tetratricopeptide TPR_2 repeat protein
cHOG0312 hma RRNAC3108 tpr TPR repeat-containing protein
cHOG0312 hwa HQ3425A TPR repeat-containing protein
cHOG0312 hla HLAC2688 Hlac_2688 Tetratricopeptide TPR_2 repeat protein
cHOG0312 hbo HBOR01120 Hbor_01120 tetratricopeptide repeat protein
cHOG0312 hut HUTA1003 Huta_1003 TPR repeat-containing protein
cHOG0312 hvo HVO_0112 HVO_0112 tetratricopeptide repeat protein
cHOG0312 nph NP0994A hypothetical protein
cHOG0312 hhi 375 tpr TPR repeat-containing protein
MUSCLE (3.6) multiple sequence alignment


2468|chp|nrc1       MTDRSEDADGEPAPEDAAGLDDDALD--HEFSEGAGFDDPYAGFDLDPPELDVDPDTVDP
994|hp|nph          MTDDEPS------------------D--HAFSAGQGFEDPYEGFDIDPPELDVDPGMVDP
1003|gene|hut       MTEEPED---------------------HEFSEGQGFSEPYEGFDLEPPELNVDPDSVDP
13108|gene|hma      MTDNDDD---------------------HAFSEGQGFDDPYEGFDLEPPEFEVDPDKVDP
375|gene|hhi        MTDHDDD---------------------HAFSEGQGFDDPYEGFDLEPPEFEVDPDKVDP
2688|gene|hla       MTDKRDD------------------DR-HEFSAGQGVDAEYEEFTLDPEEIDADPNTVDP
3425|gene|hwa       MTDNEPT------------------D--HEFSSGQGFNEEYEEFTLDPPELSADPTSVDP
1120|gene|hbo       MAEDGER------------------DRPHRFSEGQGFSEDYEEFSLDPPELNVDPAKVDP
                    *::                         * ** * *..  *  * ::* *:..**  ***

2468|chp|nrc1       VDSRVVADTLDERTLDNDAVDADELIDVGLSYMGINRNEQAVDTFERAAQYTDDDNRE-Q
994|hp|nph          VDSRVVADMLDRRQISDNAVDAESLLDVGLEYMRINRFEQATDALERAASFADDETIE-Q
1003|gene|hut       VDSRVVSDLLDERSIGGDEVDAEELLDVGISYTRIQRFEEATETLERAARYAEDDSVA-Q
13108|gene|hma      VDSRVVTDLLDQRNISSDAVDPGQLLDVGLEYMHINRHEQAAETFERVAQYTDDDRLK-Q
375|gene|hhi        VDSRVVTDLLDQRNVSSDAVDPEQLLDVGLEYMHINRHEQAAETFERVAQYTDDDRLK-Q
2688|gene|hla       VDSRVLTDIMDKRNVESDAIDVERLIDVGLSYMGINRFEEATETFERAASFADEDSPEAQ
3425|gene|hwa       VDTRVITDELDKRNIASDQVDVEQLVDVGLSYMQINRFEEATETFERAARFAPEESLAAQ
1120|gene|hbo       VDTRVITDELDERNIAKDQVDVEQLVDVGLSYMQINRFEEATETFERAAQFADEDSLEAQ
                    **:**::* :* * :  : :*   *:***:.*  *:* *:*.:::**.* :: ::    *

2468|chp|nrc1       EAWVNKGIAHGELEEWDAAVGAHREALFVADDGDFEAAAHTNLAYALWEFGEDEQAYEHA
994|hp|nph          EAWVNKGAAHAELEEHQRAIDAYREALRIDDESEHAASAETNLAYALWNDGRSEQALEHA
1003|gene|hut       EAWANKGAAHAELEEYDAAMGAYREAIEIDPDSEHAATAETNLAYALWESGRSEQALEHA
13108|gene|hma      EAWTNKGAAHAELEEWDAAIGAYKEALNFDEESDHAATAETNLAYALWKSGRSEQALEHA
375|gene|hhi        EAWTNKGAAHAELEEWDAAIGAYKEALNFDEESDHAATAETNLAYALWKSGRSEQALEHA
2688|gene|hla       EAWVNKGAAHAELEEYDQAIGAYEEALRIDGDSEHAATAETNLAYALWESGRGEQALEHA
3425|gene|hwa       EAWVNKGAAHGQLEEWDEAIGSYKEALHIDDESEHAASAETNLAYALWEAGETESALQHA
1120|gene|hbo       EAWVNKGAAHAQLEEYDEAIGAYKEALRIDDDSEHAASAETNLAYALWQFGETEEALHHA
                    ***.*** **.:*** : *:.:: **: .  :.:. *:* ********: *  *.*  **

2468|chp|nrc1       EEAVRVDKRLPQAWYNLGFIENERDRPEQALDALDNAIRLGFQQADVYEEKTRALEALGR
994|hp|nph          ERAVELDQRFAQGWYNRGFFLLERGLAEDAVSCFDNAIRLGYRNADVLQEKARALEEIGE
1003|gene|hut       ERAVEIDPRFPQAWYNRGFFLLERGLAEEAIDAFDNAIRLGFRNATLLEEKARAHEEVGE
13108|gene|hma      ERAVEIDPRFGEGWYNRGFFLLERGLADEAIDAFDNAVRLGFRNADVLEEKARALEEVGE
375|gene|hhi        ERAVEIDPRFGEGWYNRGFFLLERGLADEAIDAFDNAVRLGFRNADVLEEKARALEEVGE
2688|gene|hla       ERAVEIDPRFAEAWYNRGFLLVERGLAEDAVSCFDNAIRLGYRSAGVLEEKARALEEAGE
3425|gene|hwa       ERAVKVDPRFPQAWYNRGFFLHERGLNEEAVSAFDNAIRLGMQTADVLEEKARALDELGR
1120|gene|hbo       ERAVEIDPRFAQAWYNRGFFLQERGLSEDAVNAFDNAIRLGMRNADVLEEKARALEELGR
                    * ** :* *: :.*** **:  **.  ::*:..:***:*** . * : :**:** :  * 

2468|chp|nrc1       DEEAAKVAEQADEIRSQQERELVDER----------------------------------
994|hp|nph          DEKATELAEEAEELRQEAERELVDQQ----------------------------------
1003|gene|hut       DERAEELVEEAEELRQETEEELIDDGAQTELYE---------------------------
13108|gene|hma      FDRAEELAEEVDEMREEAEQQLLE------------------------------------
375|gene|hhi        FDRAEELAEEVDEMREEAEQQLLE------------------------------------
2688|gene|hla       HEQAEEVADRADEIRREAEEQMVEEQTGQAPGPGGQGRQGGRPGGQPGAGGRGGRGGRGG
3425|gene|hwa       DEEAEQTQTQAEELRREREQELLEDQ----------------------------------
1120|gene|hbo       EDEAEQVQQQADELRQQQEQELIEDR----------------------------------
                     : * :    .:*:* : * ::::                                    

2468|chp|nrc1       --------------------
994|hp|nph          --------------------
1003|gene|hut       --------------------
13108|gene|hma      --------------------
375|gene|hhi        --------------------
2688|gene|hla       QGGTREEPERELQGEGPEGF
3425|gene|hwa       --------------------
1120|gene|hbo       --------------------