HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0310COG1497arCOG04399Predicted transcriptional regulatorpredicted transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0310 nrc1 VNG1548 calR predicted transcriptional regulator
cHOG0310 hmu HMUK2060 Hmuk_2060 regulatory protein Crp
cHOG0310 hma RRNAC3501 transcription regulator
cHOG0310 hwa HQ1568A transcription regulator
cHOG0310 hla HLAC0023 Hlac_23 regulatory protein Crp
cHOG0310 hbo HBOR24020 Hbor_24020 predicted transcriptional regulator, COG1497
cHOG0310 hut HUTA2797 Huta_2797 transcriptional regulator, MarR family
cHOG0310 hvo HVO_0815 HVO_0815 transcription regulator
cHOG0310 nph NP1628A hypothetical protein
cHOG0310 hhi 719 HAH_0719 transcription regulator
MUSCLE (3.6) multiple sequence alignment


1628|hp|nph         --------MVDVLDNKRSATKFRVLVEIADRQPAVNQGEIADAVGVTSQAVSEYIRELVD
2797|gene|hut       --------MIDVLDNKRTATRFRILVEIAERQPAVSQGEIADAVGVTSQAVSEYIRELVE
13501|gene|hma      --------MVDVLENKRAATRFRVLVEIAERQPAVSQGEIADAVGVTSQAVSEYIRELVD
719|gene|hhi        --------MVDVLENKRAATRFRVLVEIAERQPAVSQGEIADAVGVTSQAVSEYIRELVD
1568|gene|hwa       --------MSGALEDKRTATRFRILVEIADRQPAVNQGEIAEAVGVTSQAVSEYIRDLVA
24020|hp|hbo        --------MSGALEDKRTATRLRILVEIANRQPAVSQGEVAEAVGVTSQAVSEYTRQLVE
815|gene|hvo        --------MSGALEDKRTATRFRILAEIADRQPAVSQGEIAEAVGVTSQAVSEYIRDLVE
23|gene|hla         MTDSDRATPPEVLDSKRDATRYQVLVEIAARQPAVSQTEIAEAIGVTSQAVSDYVRDLVE
1548|chp|nrc1       MVESRANGDLGVLRSKRNATRYQILVEIAERQPAVSQQEIADEIGVTAQAVSDYLGDLVE
                               .* .** **. .:*.*** *****.* *:*: :***:****:*  :** 

1628|hp|nph         EGFVEKEARSRYRVTKEGVDWLFQQAADVSRFAEHVTEDVLGSMQEDAAFAADDIAAGET
2797|gene|hut       DGFVEKEGRSRYRVTNEGVDWLFGAATDVRRFADHVTDDVLGSVQEDAAIALKPVNEGQT
13501|gene|hma      DGLVEKEGRSRYRVTKEGVDWVFQSATDVRRFADHVTDDVLGSVQEDAAIATADLAEGET
719|gene|hhi        DGLVEKEGRSRYRVTKEGVDWVFQSATDVRRFADHVTDDVLGSVQEDAAIATADLAEGET
1568|gene|hwa       EGYVDKEARSRYTITKEGVDWLFQEAKGLRRFVNHVTDDVLENVKEDAAIATDAIEPGET
24020|hp|hbo        DGYVEKEGRSRYHVTKEGVDWLFQEAKDLRRFADHVTDDVLENVQEDAAIATEELSSGET
815|gene|hvo        DGLVEKQGRSRYRVTKEGVDWLFQEARALQRFAEHVTDDVLESVNEDAAIVTEDVAAGDT
23|gene|hla         HEYVEKEGRGRYTVTKEGVDWLISRTDSLEAYLNRVSSDVLGSVDVDAAIAMDDIAEGSD
1548|chp|nrc1       EGHARKHGRGRYEVTKEGVDWLISQTDDLRTFVEYVSESVLEEVDVDTAVADADIDDGER
                       . * .*.** :*:*****::  :  :  : : *:..** .:. *:*..   :  *. 

1628|hp|nph         VSLSISDGLLYATPGDSGPATGVATTDAETGDVVGVTGFAGIIDLDPGSVTVFQVPPIRS
2797|gene|hut       VTLSIADGLLQARPG-DGEATGVATTDAEAGEVVGVTGFEGVIDLEPGEVTILQVPPIRS
13501|gene|hma      VTLSLSDGLLHADPG-GGDATGVTTTSAAEGEVVGVTGFEGVIDLDPGHVSVIQVPPVRS
719|gene|hhi        VTLSLSDGLLHADPG-GGDATGVTTTSAAEGEVVGVTGFEGVIDLNPGHVSVIQVPPVRS
1568|gene|hwa       VTLSITDGLLHATPGDAGPATGVATTAADSGDEVSVTGFEGVIQMDPGHVTVIQLPPARS
24020|hp|hbo        VTLTVRDGLLHATPGESGPATGVATTDAEKGEDVSITGFEGIIEIDPGSVTVVQVPPTRS
815|gene|hvo        VTLSLREGLLHATPGDDGPAIGVATTDAEAGGAASVTGFEGVIEMEPGSVRVLQVPPARL
23|gene|hla         VGLLMRNGVLHANPA-GGTATAVTVTAAAAGEAVGVADFEGVVDYETGYVTVLPVPAVTD
1548|chp|nrc1       VSLSMHDGVMHATPGADGSATAVAVTGAAAGQDVGTAEFDGMLDYEPGEVTVLSTPVVQD
                    * * : :*:: * *.  * * .*:.* *  *  .. : * *::: :.* * :.  *    

1628|hp|nph         GDP--SGSPELADTAADADVVAAAGVEGVAALRDVDADPDVTFAAGEVAADAAGRGLDVV
2797|gene|hut       DED--PPLDRLTDAVETADLVAAAGVEAVGALRRIDHEPATHFGAGEVAADAASRGLDVV
13501|gene|hma      GPV--ENIDDIAAACADVPIVTAAGVESVVALRDADIEPTTHFAAGEVAAAAASRGLDAV
719|gene|hhi        GPV--ENVDDIAAACADAPIVTAAGVEAVVALRDADIEPTTHFAAGEVAADAASRGLDAV
1568|gene|hwa       GGSQVVSIDELATICAGGDIVVATGVEAVVALRRADITPTTSLAAGSVAADGATRGLDSV
24020|hp|hbo        GGSRAVDLETLAEMCDDADVVAATGIEAIVSLRKADVEMETSWAAGDVAEAAAARGLSAI
815|gene|hvo        AESDAVGSDALAAACDDADIVVAAGIEAVVACRHASVDVRTWFAPGEVAADAAARGLDVA
23|gene|hla         AAS--VAPDVLTATRPSESLLAVAGTEAYALAARADAHPDIRFGTVDAVAEAAVRGMNVL
1548|chp|nrc1       GGSGALPDDAVTARLAAHDIVAAAGVEALVAVRDAGSEPDIRFGTASAVPAAASRGLSVL
                              ::       ::..:* *.       .       .. ...  .* **:.  

1628|hp|nph         VVATTDLAGRVTDALRDAGIAYEVDDI-------------------
2797|gene|hut       VVATTDAVGRVTDALRDSDVSYSVT---------------------
13501|gene|hma      VVATQDTVGRVTDALRDASVDYDVTQ--------------------
719|gene|hhi        VVATQDTVGRVTDALRDASVDYDVTQ--------------------
1568|gene|hwa       VVATVDLVGQVTDTLRDDNVLYEVTQLADADVDPDMNANITHRDSE
24020|hp|hbo        VVVTTDLVGRVTDVLRDGDVLYEVTEAARIAE--------------
815|gene|hvo        VVASTDTAGRVTDALRDAGVLFEVTEP-------------------
23|gene|hla         LIVTADQLPKHTARLRDENIPHEVLDAGDF----------------
1548|chp|nrc1       LVVTADRLSEHTDPLRERNLGYEVVGPGLD----------------
                    ::.: *     *  **: .: ..*