HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0031COG0605KOG0876arCOG04147Superoxide dismutasesuperoxide dismutase

HOG Organism Gene ID Name Annotation
cHOG0031 nrc1 VNG1190 sod1 superoxide dismutase
cHOG0031 nrc1 VNG1332 sod2 superoxide dismutase
cHOG0031 hmu HMUK2542 Hmuk_2542 Superoxide dismutase( EC:1.15.1.1,EC:1.15.1.1 )
cHOG0031 hmu HMUK3234b Hmuk_3234 Superoxide dismutase( EC:1.15.1.1,EC:1.15.1.1 )
cHOG0031 hma RRNAC0831 sodA superoxide dismutase [Mn] 2
cHOG0031 hwa HQ2461A sod superoxide dismutase
cHOG0031 hla HLAC2515 Hlac_2515 manganese and iron superoxide dismutase
cHOG0031 hla HLAC1650 Hlac_1650 manganese and iron superoxide dismutase
cHOG0031 hbo HBOR14400 Hbor_14400 superoxide dismutase( EC:1.15.1.1,EC:1.15.1.1 )
cHOG0031 hut HUTA2880 Huta_2880 Superoxide dismutase
cHOG0031 hut HUTA2178 Huta_2178 Superoxide dismutase
cHOG0031 hvo HVO_2913 HVO_2913 superoxide dismutase (Fe/Mn)
cHOG0031 nph NP4040A sod superoxide dismutase
cHOG0031 hhi 1470 sodA superoxide dismutase
MUSCLE (3.6) multiple sequence alignment


2880|gene|hut       --MSEHSNPELPSLPYDYDALEPHISEQVLEWHHDTHHQGYVNGLGAAEETLAENRASGD
4040|gene|nph       --MPEHSNPELPPLPYDYDALEPSISEQVVTWHHDTHHQGYVNGLESAEETLAENREAGE
10831|gene|hma      --MSEHSNPELPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGLESAEETLAENRDAGD
1470|gene|hhi       --MPEHSNPELPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGLESAEETLAENRESGD
2461|gene|hwa       ------MSYELDPLPYEYDALEPQLSEQVLTWHHDTHQQGYVNGWNNAEAELEENRDSHD
2515|gene|hla       MEMNVDMSYELDPLPYDYDALEPHISEQVLEWHHDTHHQGYVNGWNSAEETLEANRDAGD
1650|gene|hla       ------MSYELDPLPYDYDALEPHLSEQVLEWHHDTHHQGYVNGWNSAEETLEANREEHD
2178|gene|hut       -----MSDYELPPLPYDYDALEPHISEQVLRWHHDTHHQGYVNGWNAAEETLAENREAGE
14400|gene|hbo      ------MSYELDPLPYEYDALEPHISEQVLTWHHDTHHQGYVNGWNSAEETLESNREEGD
2913|gene|hvo       ------MSYELDPLPYEYDALEPHISEQVLTWHHDTHHQGYVNGWNAAEETLAENREAGE
1190|gene|nrc1      -----MSEYELPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGWNDAEETLAENRETGD
1332|gene|nrc1      -----MSQHELPSLPYDYDALEPHISEQVVTWHHDTHHQSYVDGLNSAEETLAENRETGD
                           . ** .***:****** :****: ******:*.**:*   **  *  **   :

2880|gene|hut       HGTTGGALGNVTHNGSGHYLHTLFWENMSPNGGGKPEGALLERIEEDFGSYDAWKAEFEA
4040|gene|nph       FGGSAAAIRNVTHNGSGHYLHTLFWENMDPNGGGEPSGDLADRIEEDFGSYEGWKGEFKA
10831|gene|hma      FGSSAAAMGNVTHNGCGHYLHTLFWENMDPNGGGEPEGELLDRIEEDFGSYEGWKGEFEA
1470|gene|hhi       FGSSAAAMGNVTHNGCGHYLHTLFWENMDPNGGGEPEGELLDRIEEDFGSYEGWKGEFEA
2461|gene|hwa       FSSSAGAIRDVTHNSSGHLLHDLFWQCMSPEGGDEPTGDLGDRIEEDFGSYDAWRGEFEA
2515|gene|hla       FSSSGGAIRNVTHNSSGHILHDLFWQNMSPEGGDEPEGALADQIEEDFGSYDAWKGEFEA
1650|gene|hla       FSSSGGAIRNVTHNSSGHILHDLFWQNMSPEGGDEPDGALADRIAEDFGSYDAWKGEFEA
2178|gene|hut       FDSSAGAIRNVTHNGSGHVLHDLFWQSMSPEGGDEPAGDLRERIEEDFGSYDAWKGEFEA
14400|gene|hbo      FGSSPGAIRNVTHNGCGHILHDLFWNSMSPEGGSEPTGSLADRIEEDFGSYEAWKGEFEA
2913|gene|hvo       FGSSAGALRNVTHNGSGHILHDLFWQNMSPEGGDEPEGALAERIAEDFGSYEAWKGEFEA
1190|gene|nrc1      HASTAGALGDVTHNGSGHILHTLFWQSMSPAGGDEPSGALADRIAADFGSYENWRAEFEA
1332|gene|nrc1      HASTAGALGDVTHNGCGHYLHTMFWEHMSPDGGGEPSGALADRIAADFGSYENWRAEFEV
                    .  : .*: :****..** ** :**: *.* **.:* * * :.*  *****: *..**:.

2880|gene|hut       AAGAAGGWALLVYDPVAKQLRNVAVDKHDNGALWGSHPILALDVWEHSYYYDYGPDRGSF
4040|gene|nph       AAGAAGGWALLVYDPVADQLRNLVVDKHDQGALWGSHPILALDVWEHSYYYDYGPDRGEF
10831|gene|hma      AASAAGGWALLVYDPVAKQLRNVPVDKHDQGALWGSHPILALDVWEHSYYYDYGPARGDF
1470|gene|hhi       AASAAGGWALLVYDPVAKQLRNVPVDKHDQGALWGSHPILALDVWEHSYYYDYGPARGDF
2461|gene|hwa       AAGDASGWALLVYDSFSNQLRNVVVDNHDEGAFWGAHPVLSLDVWEHSYYHDYGPARGDF
2515|gene|hla       AASAASGWALLVYDTFSNQLRNVVVDKHDQGAIWGGHPILALDVWEHSYYHDYGPARGEF
1650|gene|hla       AASAASGWALLVYDTFSNQLRNVVVDKHDQGAIWGGHPILALDVWEHSYYHDYGPARGEF
2178|gene|hut       AASGAGGWALLVYDSFSNQLRNVVVDKHDQGALWGSHPVLALDVWEHSYYHDYGPARGDF
14400|gene|hbo      AAGNAGGWALLVYDSFSNQLRNVVVDKHDQGALWGSHPILALDVWEHSYYHDYGPARGDF
2913|gene|hvo       AAGAAGGWALLVYDSFSNQLRNVVVDKHDQGALWGSHPILALDVWEHSYYHDYGPARGDF
1190|gene|nrc1      AASAASGWALLVYDSHSNTLRNVAVDNHDEGALWGSHPILALDVWEHSYYYDYGPDRGSF
1332|gene|nrc1      AAGAASGWALLVYDPVAKQLRNVAVDNHDEGALWGSHPILALDVWEHSYYYDYGPDRGSF
                    **. *.********. :. ***: **:**:**:**.**:*:*********:**** **.*

2880|gene|hut       IDAFFEVVNWETVADEYQKCLDHFE
4040|gene|nph       IDGFFEVVDWDNVAEQYEKATQQ--
10831|gene|hma      IDAFFEVVDWDKAAEEYEKSVSHFE
1470|gene|hhi       IDAFFEVVDWDKAAEEYDKVVGRVE
2461|gene|hwa       VDAFFEVVDWEEPSQRYAQAVELFE
2515|gene|hla       VDNFFEVVDWNEPATRYEQAVELFE
1650|gene|hla       VDNFFEVVDWNEPATRYEQAVELFE
2178|gene|hut       VANFFEVVDWEEPAARFEQAVELFE
14400|gene|hbo      IDAFFEVVDWEEPSARYEQAVELFE
2913|gene|hvo       VSAFFEVVDWDEPAARYEQAVELFE
1190|gene|nrc1      VDAFFEVVDWDEPTERFEQAAERFE
1332|gene|nrc1      VDAFFEVIDWDPIAANYDDVVSLFE
                    :  ****::*:  :  : .