HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0309COG2511arCOG01719Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain)Glu-tRNA amidotransferase

HOG Organism Gene ID Name Annotation
cHOG0309 nrc1 VNG1352 gatB1 Glu-tRNA amidotransferase
cHOG0309 hmu HMUK2776 Hmuk_2776 aspartyl-tRNA(Asn) amidotransferase, B subunit( EC:6.3.5.7 )
cHOG0309 hma RRNAC0023 gatE glutamyl-tRNA(Gln) amidotransferase subunit E
cHOG0309 hwa HQ2468A gatE glutamyl-tRNA(Gln) amidotransferase subunit E
cHOG0309 hla HLAC1472 Hlac_1472 aspartyl-tRNA(Asn) amidotransferase, B subunit
cHOG0309 hbo HBOR14270 Hbor_14270 glutamyl-tRNA(Gln) amidotransferase subunit E( EC:6.3.5.7 )
cHOG0309 hut HUTA2658 Huta_2658 aspartyl-tRNA(Asn) amidotransferase, B subunit
cHOG0309 hvo HVO_2902 HVO_2902 gatE glutamyl-tRNA(Gln) amidotransferase subunit E
cHOG0309 nph NP3774A gatE glutamyl-tRNA(Gln) amidotransferase subunit E
cHOG0309 hhi 785 gatE glutamyl-tRNA(Gln) amidotransferase subunit E
cHOG0309 hhi 4407 HAH_4407 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4407|hp|hhi         ----------------------------------------MTTKRPF-------------
2468|gene|hwa       MTATSANSDVDSEKTTTDDDTEYDYADLGLVAGLEIHQQLNTETKLFCECPTQSRDPEAA
2658|gene|hut       ------------------MTEDFDYEALGLVAGLEIHQQLDTAAKLFCECPTTLREPDES
1352|gene|nrc1      -------------------MTEFDYDELGLVAGLEIHQQLDTATKLFCACPTTRREPAEA
3774|gene|nph       --------------------MSYDYEDLGLVAGLEIHQQLDTETKLFCNCPTERREPEEA
1472|gene|hla       --------------MSTDATPEYDHEELGLVAGLEIHQQLDTATKLFCDSPTTERDPEDS
14270|gene|hbo      -------------------MSAYDYEDLGLVAGLEIHQQLDTESKLFCGCPTEIREPEDA
10023|gene|hma      -------------------MTEYDYEELGLVAGLEIHQQLDTATKLFCDCPTTIREPEES
785|gene|hhi        -------------------MTEYDYEELGLVAGLEIHQQLDTATKLFCDCPTTIREPEES
                                                             *  . *             

4407|hp|hhi         -----------------------------RDF----------------------------
2468|gene|hwa       TYSFTRYLHPTTSELGELDKAALEESQVKREFEYLGYDSTCLVEADEEPPHRLDTEAQNV
2658|gene|hut       TTTITRYLHPTKSELGELDEAALEESQVEREFEYLTYDSTCLVEADDEPPHRVDDEAMAV
1352|gene|nrc1      DRTFTRYLHPTRSELGEIDEAALEESRVEREFEYLAYDTTCLVEEDDEPPHRLDEDALAA
3774|gene|nph       VRSFTRYLHPTKSELGELDEAALEESRVDREFEYLAFDTTCLVEEDDEPPHRLDEEALAT
1472|gene|hla       DREITRRLHPTKSELGELDDAAMEESRVDREFTYLAYDTTCLVEEDDEPPRRIDGEALSV
14270|gene|hbo      ERTFTRFLHPTKSELGELDEAALEESRVEREFEYLSYDTTCLVEEDDEPPHRLDEEAREV
10023|gene|hma      DRSFTRYLHPTKSELGEIDEAALEESMVDREFEYLAYDTTCLVEEDDEPPHRVDREAMET
785|gene|hhi        ERSFTRYLHPTKSELGEIDQAALEESMVDREFEYLAYDTTCLVEEDDEPPHRVDREAMET
                                                 *:*                            

4407|hp|hhi         TDRIAQFAD---------------------------------------GRRGIRN-----
2468|gene|hwa       ALQIADLLEMEPVDQAHVMRKLVIDGSNTSGFQRSTLIAQDGTIQTDAGAVGIEDLLLEE
2658|gene|hut       ALEIAQLLDMRAVDQVHVMRKLVIDGSNTSGFQRTMMVATDGEIETSEGPVGVEDLMLEE
1352|gene|nrc1      ALEIGHLLGMDAVDRAHVMRKVVIDGSNTGGFQRSTMVAEGGAIDTSEGPVGIEDLMLEE
3774|gene|nph       AMEIATLLDCSVVDQAQVMRKIVVDGSNTSGFQRSTLLATDGEIETDEGAVRIADMLLEE
1472|gene|hla       ALQVADLLDISVVDQAHVMRKLVIDGSNTSGFQRSILLGQAGEIETSEGRVSIADLMLEE
14270|gene|hbo      VMQIASLLDMDAVDQAHLMRKLVIDGSNTSGFQRTTLVAQDGEIETSDGPVGVEDLMLEE
10023|gene|hma      TLEIAQLLDMSVADQVNIMRKIVVDGSNTTGFQRSMLVANDGAIETSAGPVGVEDMLLEE
785|gene|hhi        TLEIAQLLDMSVVDQVNVMRKIVVDGSNTTGFQRSMLVANDGAIETSAGPVGIEDMLLEE
                    .  :. :                                         *   : :     

4407|hp|hhi         ----------------------PFVIVPVQPKY---------------------------
2468|gene|hwa       ESAQRIEERDGAVTFSLDRLGIPLVEIGTRPDIATPEQAQDAAEQIGMLLRSTGSVKRGL
2658|gene|hut       ESAQRVQETDSGVRYSLDRLGIPLVEIGTDPDIRSPAQAQEAAERIGMLLRSTGQVRRGL
1352|gene|nrc1      ESAQRIEDREDGVLYSLDRLGIPLVEIGTKPDISSPAQAREAAERIGMLLRSTGKVKRGL
3774|gene|nph       ESAARIEEHDDGVTYGLDRLGIPLVEIGTKPDIRTPTQAREAAERIGMLLRSTGKVKRGL
1472|gene|hla       ESAKRVEETEEGVVYSLDRLGVPLVEIGTGPDIRSPEGAREAAERIGMLLRSTGAVKRGL
14270|gene|hbo      ESAQRVEETDDGVRFSLDRLGIPLVEIGTRPDISSPEQAREAAERIGMLLRSTGKVKRGL
10023|gene|hma      ESCQRIEETEDGVRFSLDRLGIPLVEIGTKPDISSPEQAREAAERIGMLLRSTGKVKRGL
785|gene|hhi        ESCQRVEETADGVRFSLDRLGIPLVEIGTKPDISSPEQAREAAERIGMLLRSTGKVKRGL
                                          *:* : . *.                            

4407|hp|hhi         ------------------------------------------------------------
2468|gene|hwa       GTIRQDVNVSIAEGARVEIKGVQALDQIDEIVRQEVARQVELVDIQTELLRRDADVGEIQ
2658|gene|hut       GTIRQDVNVSIAEGARVEIKGVQSLEDIEAIVRNEVGRQAELLDIAEELDDRDATVGDPQ
1352|gene|nrc1      GTIRQDVNVSIADGARVEMKGVQSLDDIDDLVREEVRRQVELLDIVDELDARDAAVGKPR
3774|gene|nph       GTIRQDVNVSIEEGARVEMKGVQSLDDIDDLVENEVGRQIELLDIAETLRERDAAVGEPR
1472|gene|hla       GTIRQDVNVSIADGARVEVKGVQDLQGIEDIVRGEVGRQAELLEIRDELVERDASVGDVR
14270|gene|hbo      GTIRQDVNVSIADGARVEIKGVQALDAIDDIVRNEVGRQVKLLDIRDELAERDASVGDTQ
10023|gene|hma      GTIRQDVNVSIEEGARIELKGVQSLDDIDDLVRNEVRRQVELLDIAEELAERGATVGEPQ
785|gene|hhi        GTIRQDVNVSIEEGARIELKGVQSLDDIDDLVRNEVRRQVELLDIADELAGRDAAVGEPQ
                                                                                

4407|hp|hhi         ------------------------------------------ERRVAERLTEWATNP---
2468|gene|hwa       DVSTVFTDTDSGVIASTLADDGMVAAVPLYGFDRLVGRELQPDRRLGTELSDHAGRYGAG
2658|gene|hut       AVTEIFEGTDSGVIQGALTDGGDVWAVALPGFGGLVGQEIQPDRRLGTEFSDHAKRHGAG
1352|gene|nrc1      DVTDVFADTESGVIRGALDDGGEVHAVPLHGFDGLVGRELQADRRLGTEFSDHATRHGAG
3774|gene|nph       DVTEVFEDTESGVIAGA----ERVEAVRLDGFDGLVGREIQPDRRLGTELSDHAKRHGAG
1472|gene|hla       DVTDTFADTESGVIRGALDSGGKVTAVPLFGFDGLVGREIQPDRRLGTELSDHAKRHGAG
14270|gene|hbo      DVTDVFEDTDSGVIGGALSSGGVVQAVPLFGFDGLVGREIQPDRRLGTEFSDHAKRHGAG
10023|gene|hma      DVTEVFEDTDSGVIEGALSSGGKVQGLLLSGFDGLVGREIQPDRRLGTELSDHAKRHGAG
785|gene|hhi        DVTGVFEDTESGVIEGALSSGGEVQGLLLSGFDGLVGREIQPDRRLGTELSDHAKRHGAG
                                                              :**:.  :::.* .    

4407|hp|hhi         --HRTEEFP---------------------------------------------------
2468|gene|hwa       GIFHTDELPAYGISESEVNSLYNVV--------DAGENDAVALVAADPETAEQAAAAVAE
2658|gene|hut       GIFHTDELPAYGVTEAEVEALAEAVDLDPDAVTGEESEDAVAIVADAPEIAEQSIEAVAE
1352|gene|nrc1      GIFHTDELPAYGVTAAEVAALRDAV--------GAGEDDAVAIVADDPETAAQSIQAVAE
3774|gene|nph       GIFHTDELPAYGVSEAEVEALRDAV--------GADAADAVALVAADTDVAETAIEAVAD
1472|gene|hla       GIFHTDELPAYGVTEEEVAALRDAV--------GADEDDAVAIVAADPETADLTIEAAAE
14270|gene|hbo      GIFHTDELPAYGVTEAEVTALRDAV--------DADENDAVAIVATDPETAELAIDAVKE
10023|gene|hma      GIFHTDELPAYGVTEAEVEALRDAV--------GAGSEDAVAIVADDPETAELAIDAVAE
785|gene|hhi        GIFHTDELPAYGVTEAEVEALRDAV--------GAGPEDAVAIVADDPETAELAIDAVAE
                      ..*:*:*                                                   

4407|hp|hhi         -----------------DDGTVQILR----LDEVFVETEVFELAVDLGKHSQPATITETM
2468|gene|hwa       RAADAISGVPEETRDANDDGTTRYLRPLPGAARMYPETDVPPVTFDIGDIETPELLTERV
2658|gene|hut       RAETAMDGVPEETRDATEEATTRYLRPLPGAARMYPETDVPPVEPDPEEVETPELLTEKT
1352|gene|nrc1      RAETAMAGVPEETRGANDDGTSKYLRPLPGAARMYPETDVPPVDPDPSAVETPELLTEKV
3774|gene|nph       RAETAIEGVPEETRGANEDGTSRYLRPLPGAARMYPETDVPPVEPDPSDIDPPELLTERV
1472|gene|hla       RAETAIEGIPEETRGANDDGTTRYLRPLPGAARMYPETDVPPVEPDPSDVDRPELLDEKA
14270|gene|hbo      RAETALDGVPEETRGANEDGTTRYLRPLPGAARMYPETDVPPVELDPSDVETPELLTEKV
10023|gene|hma      RAETALAGVPEETRDANEDATSRYLRPLPGAARMYPETDVPPVEPDVTEVETPELLTEKV
785|gene|hhi        RAETALEGVPEETRDANEDATSRYLRPLPGAARMYPETDVPPVEPDVTEVETPELLTQKV
                                     ::.* . **       :: **:*  :  *    . *  : :  

4407|hp|hhi         QDRLAEEL---VGI------------MLDRIEAPGEQRHVVLLTHLGSLYPFTRASELLD
2468|gene|hwa       -ERYQSKLNLDLGLAEQIAYGRRMSLFETAVD-MGIDPTFAASLLTATLTELRRDGVAVE
2658|gene|hut       -ERYQEDFDLDAGLAEQVAYGKRWELFEEAVE-SGVDATLAAQTVESTVTEIRRDGAPVE
1352|gene|nrc1      -ERYQADFDLDAGLAEQVAYGRRWQLFEQQVE-AGVDATLAAQTLESTVTELRRDDVPVG
3774|gene|nph       -DRYQSDLGLDAGLAEQVAYGRYMPVFETAVD-RGVDPTTAAGTLASTLTELRRDDVAVE
1472|gene|hla       -ERYTEAFGLDAGLAEQVAFGQRFPLFETAVD-RGVDPTFAASTLESTTTEIRRDGAPVE
14270|gene|hbo      -ERYQSEFGLGAGLAEQVAYGRKMPLFERAID-EGIDATFAAGLLESTLTELRRDDVAVE
10023|gene|hma      -DRYESEFDLGSGLAEQVAYGQRWPLFEALVAGEGVDPTLAAGTLESTLTELRRDDVPVE
785|gene|hhi        -DRYESEFDLGSGLAEQVAYGQRWPLFEALVEGEGVDPTLAAGTLESTLTELRRDDVPVG
                     :*    :    *:            :   :   * :   .     .:   : * .  : 

4407|hp|hhi         ELDRRNVQSTIGIPFPGDI----VGGKLSFFGEES-------------------------
2468|gene|hwa       TLTDDHLLSVMQLVSADELAKEGVGPVITKLTEDPTRSAADAVEAAGLSGVSESEVRSAV
2658|gene|hut       HLTDDHFQSVFGLLAEDELAKEGVPDLLAALAENPDLSAEEAAEQEGLGSAGEDEVREAV
1352|gene|nrc1      RLTDAHFRGVLGLVADGDLAQEGVPELLAALAEQPGSDPAVLAEELGLGSAAEDEVREAV
3774|gene|nph       NLTDEHLLSVLELVEAGDLPQEGINPALETLADDPSLTAEAAVEEAGLGGVDRETVREAV
1472|gene|hla       NLSYEHFLDLFDLVEDGDLAKEGVPKVLTTLAEDPSLSAAEAVEEAGLSGVSEAEVREAV
14270|gene|hbo      TVSDDHLLELMHLVEDGDLAKEGVNDVLSTIAENPSLSAEEAVEEAGLSGVSEDEVRDAV
10023|gene|hma      NLTDKHLQGAILLVDGGDVPREGMEDLLTALAENPSLTAEEAVEQEGLGGVDESEVRDAV
785|gene|hhi        NLTDEHLWGAILLVDGGDVPREGIEDLLTALAEKPSLTAQEAVEQEGLGGVDESEVRDAV
                     :   :.   : :   .::    :   :  : :..                         

4407|hp|hhi         -----RNY----------YPA------HQIEGRVEGVHLQ-----------
2468|gene|hwa       IDVVERNAEQVDEEGMAAFSALMGEAMGALRGKADGEVVSDILRETIQKRI
2658|gene|hut       VTVVERNASQIEDEGMGAFSGLMGECMGELRGKADGDVVSDVLREEIQKRA
1352|gene|nrc1      VGVVERNSDQVAAEGMGAFSALMGECMGALRGKADGDLVSEVLREEIQQRS
3774|gene|nph       VEVIERNADQVEAEGMGAFSGLMGECMGQLRGKADGEVVSELLREEIQKRA
1472|gene|hla       VEVVERNADQIEAEGMGAFSGLMGEAMGALRGKADGEIVSDVLREEIGKRS
14270|gene|hbo      SGVVERNADQVEEEGMAAFSALMGEAMGALRGKADGEIVSTVLREEIQKRA
10023|gene|hma      AEVVERHEDQVAEEGMGAFSALMGECMGALRGKADGDTVSDVLRSEIQKRA
785|gene|hhi        VEVVERHEDQIAEEGMGAFSALMGECMGALRGKADGDTVSDVLRSEIQKRA
                         *:           :..        : *..:*  :.