HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0308COG0557KOG2102arCOG04686Exoribonuclease Rribonuclease II family protein

HOG Organism Gene ID Name Annotation
cHOG0308 nrc1 VNG2647 vacB ribonuclease II family protein
cHOG0308 hmu HMUK0272 Hmuk_0272 ribonuclease II
cHOG0308 hma RRNAC2072 vacB ribonuclease R
cHOG0308 hwa HQ3180A vacB ribonuclease R-like protein
cHOG0308 hla HLAC0359 Hlac_359 ribonuclease II
cHOG0308 hbo HBOR28040 Hbor_28040 exoribonuclease R
cHOG0308 hut HUTA0142 Huta_0142 ribonuclease II
cHOG0308 hvo HVO_0388 HVO_0388 vacB ribonuclease R
cHOG0308 nph NP0874A ribonuclease R-like protein
cHOG0308 hhi 2566 vacB ribonuclease R
MUSCLE (3.6) multiple sequence alignment


2647|gene|nrc1      MSDSE----PAQGSIEDQGPVEISPELARQLENKRDDLFEKFDLHDEFPPDVVAEAEART
142|gene|hut        MTANEEDEQAAAGTPEGQGPVEIDEELARHLENKREELFEKFEIPDGFPPEVLEEAKART
12072|gene|hma      MTTEDAQ--AAAGTAEGQGPVEIDPEMARHLENKREELFEKFGIPDEFPPEVLEEAKERT
2566|gene|hhi       MTTEDAQ--AAAGTAEGQGPVEIDPEMARHLENKREELFEKFGIPDEFPPEVLEEAKERT
874|gene|nph        MTDRDEQ--AYAGTAEGKGPVQIDEELARHLKNKREELFEEFEIRDEFPSEVLQEAEERA
359|gene|hla        MSDDE----PKPGSAEDQGPVTITPELADRLAEKRTELFEEFEIRDEFPNEVLREAETRT
3180|gene|hwa       MSNNAQQSQSEAGTAAGQGPVEISVDLARRLQEKREELFEEFGIRDAFPPAVRQEAKART
28040|gene|hbo      MSNDAQ---AQAGTAEGQGPVEISPDVARQLQDKREELFEEFEIRDAFPGPVLSEARERT
388|gene|hvo        MSDDAQ---AYAGTAEGQGPVEIDAELARHLQNKREELFEEFEIRDAFPPEVLSEARART
                    *:       .  *:  .:*** *  ::* .* :** :***:* : * **  *  **  *:

2647|gene|nrc1      EDVQAEIQAEIEDRADMRPLPTWTVDPVDAQDFDDAISVLERDDEYVLWVHIADVTHYVH
142|gene|hut        EDVGSEIEAEIDERRDLREMTTWTTDPIDAQDFDDAISIEHRDDEIVLWVHIADVTHYVN
12072|gene|hma      KGVQAEIEDEVDERQDLREMTTWTTDPIDAQDFDDAISIEEREDEIVLWVHIADVTHYVN
2566|gene|hhi       QGVQAEIEDEVDEREDLREMTTWTTDPIDAQDFDDAISIEEREDEIVLWVHIADVTHYVN
874|gene|nph        EDPEGDIVDELEERRDLRDLTTWTTDPADAQDFDDAISVKRTDDGYRLWVHIADVTHYVT
359|gene|hla        EDVYEEIEAEIDERKDLRDLTTWTTDPIDAQDFDDAISIEREEGAYRLWVHIADVTHYVT
3180|gene|hwa       EDVNEEIQDELDSRTDLRELTTWTTDPVDAQDFDDALSIRENDETYTLWVHIADVSHYVH
28040|gene|hbo      KGVQDEIQEEVEQRQDLRDLTTWTTDPIDAQDFDDAISIAENEETYTLWVHIADVTHYVH
388|gene|hvo        DGVHEEIEDELEHRKDLRDLTTWTTDPVDAQDFDDALSIRENEETYTLWVHIADVTHYVH
                    ..   :*  *:: * *:* :.***.** ********:*:   :    ********:*** 

2647|gene|nrc1      PDSEMWAEAIDRANTVYLPGYTMHMLPPVLAETVCSLVPGEDRLAHTVEMHLDKDDLSYQ
142|gene|hut        PDTAMWSSAVERANTVYLPGYTVHMLPPILAETVCSLVPNEDRLAHTVEMHLDPETLSYE
12072|gene|hma      PDTKMWEQAVERGNTVYLPAYTVHMLPPVLAETVCSLVPNEDRLAHTVEMHLDKENLGYE
2566|gene|hhi       PDTKMWEQAVERGNTVYLPAYTVHMLPPVLAETVCSLVPNEDRLAHTVEMHLDKENLGYE
874|gene|nph        PETAMWDEALERANTVYLPAYTTHMLPPVLAETVCSLVPNEDRLAHTVEMHIDGETLSHE
359|gene|hla        PDTAMWEEAVKRANTVYLPDYTIHMLPPVLAETVCSLVPNEDRLAHTVEMEIDDETLSFE
3180|gene|hwa       PDSEMWTEAVERGNTVYLPAYTIHMLPPVLAETVCSLVPEKDRLAHTVEMEISKETLSFE
28040|gene|hbo      PGSEMWEEAVKRGNTVYLPAYTIHMLPPILAETVCSLVPNEDRLAHTVEMEIDKETLSFE
388|gene|hvo        PGSEMWAEAVKRGNTVYLPAYTIHMLPPALAETVCSLVPEEDRLAHTVEMEIKKDTLSFE
                    * : ** .*:.*.****** ** ***** ********** :********* :. : *..:

2647|gene|nrc1      TIEIYKSVIHSDERLTYKD----------AEQRLDDETAPLHDDLSLVFDLADQMHEQRK
142|gene|hut        NIEIYKSVIRSDARLTYTEAERLLDEPETAEDVLEDQSVDLAEKTQAIWELADQMHEQRK
12072|gene|hma      EINIYKSVIRSDARLTYTEAERLLDEPETAEDVLEDQSVDLAEKTERVWELADRMHEQRK
2566|gene|hhi       EINIYKSVIRSDARLTYTEAERLLDEPETAEDVLEDQSVDLAEKTERVWELADRMHEQRK
874|gene|nph        SIDIYKSVIHSDARQTYND----------CEDRLDDEDAPLHEENQLAYELAEKLHEQRK
359|gene|hla        DIDIYKSVINSDERLTYKE----------CEERLEDPSLPLGEENELAYELADRMHEQRK
3180|gene|hwa       ELDIYKSVIHSDARLTYTE----------CETHLEDSNAELHAENKLAYELADQLHEQRK
28040|gene|hbo      EIDIYKSVIESDERLTYSQ----------AEERLDDESLPLHEECKLVFELADRMHEQRK
388|gene|hvo        SIDIYKSVIHSNERLTYTQ----------CENRLEDPDLPLHEENALVFDLADQLHEQRK
                     ::****** *: * **.:          .*  *:*    *  .    ::**:.:*****

2647|gene|nrc1      AEGSLVLNPRRDRAHTIIEESMLKANKAVTHELMWNRGVEAVYRVHPQPSPEEWDDALQE
142|gene|hut        ADGSLVLNPRRDRAHTIIEECMLKANKAVTHVLMWDRGVEAMYRVHPQPSPEEWNEALQE
12072|gene|hma      EEGSLVLNPARDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQPSPDEWDEALVE
2566|gene|hhi       EEGSLVLNPARDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQPSPDEWDEALVE
874|gene|nph        EDGSLVLNPKRDRAHTIIEECMLKANKAVTHTLQWDRGVEAMFRVHPQPTPDEWNEALQE
359|gene|hla        EDGSLVLNPSRDRAHTIIEESMLKANKAVTHTLMWDRGVEAMYRVHPQPTPDQWSKALRE
3180|gene|hwa       ADGSLVLNPSRDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQPTPTQWDEALRE
28040|gene|hbo      EDGSLVLNPSRDRAHTIIEECMLKANKAVTHELMWGRGVEAMYRVHPQPTPDQWDKALRE
388|gene|hvo        EDGSLVLNPSRDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQPTPDQWDKALRE
                     :******* **********.********** * *.*****::******:* :*..** *

2647|gene|nrc1      IQELNGVSIPGDAW-DDPRKAVNATLEQAPERQLGKIQWAVMKVMPRARYMNDPFGGHHA
142|gene|hut        IQDLGGVSIPGGGW-DDPRQAVNATLEDAPERQLDKIQWAVMKVMPRAKYMNDPFGGHHA
12072|gene|hma      IQELDGVSIPGDAW-DDPRKAVNATLEQAPGRQLDKIQWAVMKVMPRAKYMNDPFGGHHA
2566|gene|hhi       IQELDGVSIPGDAW-DDPRKAVNATLEQAPGRQLDKIQWAVMKVMPRAKYMNDPFGGHHA
874|gene|nph        IQDLDGVSIPGEAW-EDPRKAVNATLEEAPRRQLDKIQWAVMKVMPRAKYMSDPFGGHHA
359|gene|hla        IQELDGVSIPGDAWGDDPRKAVNAALETAPDRQLNKIQRAVLKVMPRAKYMNDPFGGHHA
3180|gene|hwa       ITELDGVEISSTAW-DEPRKAVNSALENSKPRALDKIQRAVLKVMPRAKYMNDPFGGHYA
28040|gene|hbo      IMELDGVKIPSAKF-DDPRKAVNAALENSPGRALNKIQRAVLKVMPRAKYMNDPFGGHHA
388|gene|hvo        ITELDGVSIQSTSW-DEPRKAVNDALESANSRTLNKIQRAVLKVMPRAKYMNDPFGGHYA
                    * :*.**.* .  : ::**:*** :** :  * *.***.**:******.**.******:*

2647|gene|nrc1      LNFEIYGHFTSPIRRMSDLVNHWIVYQNDVPETLISLCDRASDKQQAGETAEREYRDFLE
142|gene|hut        LNFEIYGHFTSPIRRLSDLINHWIVHTNDVPEDLVALCDRASDKQKDAEQCEREYKKFLE
12072|gene|hma      LNFEIYGHFTSPIRRLSDLINHWIVYSNDVPEDLIALCDRASDRQKDAEQCEREYKNFLQ
2566|gene|hhi       LNFEIYGHFTSPIRRLSDLINHWIVYTNDVPEDLVALCDRASDRQKDAEQCEREYKNFLQ
874|gene|nph        LNFEIYGHFTSPIRRLSDLVNHWIIYTNEVPEGIADLCDHASDKQKDGETCERIYKDFLE
359|gene|hla        LNFDIYGHFTSPIRRLSDTINHWIVHENDVPENILELCDHASDKQKDGETAERLYKQFLQ
3180|gene|hwa       LNFDIYGHFTSPIRRLSDLINHWIVHENAVPEDLIGLCDRASERQKDAETAERLYKQFLE
28040|gene|hbo      LNFDIYGHFTSPIRRLSDLINHWIVHENDVPEDLVELCDRASDRQKDAETAERLYKQFLE
388|gene|hvo        LNFDIYGHFTSPIRRLSDLINHWIVHENDVPEDLVELCDRASDRQKDAETAERLYKQFLQ
                    ***:***********:** :****:: * *** :  ***.**:.*: .* .** *..**:

2647|gene|nrc1      EVGLDPDAVNNRGVTVVDSPTTSS----------------
142|gene|hut        EVGLDPAAVNNRGIEVIDSD--------------------
12072|gene|hma      EVGLDPSAVNNRGIEVVENPDDGDEDEDAEADAADAAVEE
2566|gene|hhi       EVGLDPSAVNNRGIEVVENPDDDGEDEDAEADAADAAVEE
874|gene|nph        EVGLDPHAVNNRGVEVVDDPEDADHTA-------------
359|gene|hla        EQGLDPYAVNNRGVKVVEDPEEAKHTI-------------
3180|gene|hwa       EQGIDPYAINNRGVVTIDDAGDIIDDEGLPPNE-------
28040|gene|hbo      EVGLDPYAVNNRGIVTVDDDGNVVDEDGLPPAEN------
388|gene|hvo        EVGLDPYAVNNRGIVTVDDDGEVIDENGLPPQE-------
                    * *:** *:****: .::.