HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0306COG0172KOG2509Seryl-tRNA synthetaseserine-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0306 nrc1 VNG2072 serS serine-tRNA synthetase
cHOG0306 hmu HMUK0744 Hmuk_0744 seryl-tRNA synthetase( EC:6.1.1.11 )
cHOG0306 hma RRNAC2808 serS seryl-tRNA synthetase
cHOG0306 hwa HQ3138A serS seryl-tRNA synthetase
cHOG0306 hla HLAC2073 Hlac_2073 seryl-tRNA synthetase
cHOG0306 hbo HBOR05200 Hbor_05200 seryl-tRNA synthetase( EC:6.1.1.11 )
cHOG0306 hut HUTA1764 Huta_1764 seryl-tRNA synthetase
cHOG0306 hvo HVO_1921 HVO_1921 serS seryl-tRNA synthetase
cHOG0306 nph NP1692A serS seryl-tRNA synthetase
cHOG0306 hhi 89 serS seryl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


3138|gene|hwa       --------------MIDRQLLRKNPDAIRGALDEKGVTDVNLDQILTLDQEWRERKARGD
12808|gene|hma      --------------MLSRQFVREHPETVRDAIERKGVTGVDLDEILDIDEEWRELKAEGD
89|gene|hhi         --------------MLSRQFVREHPETVRDAIERKGVTDVDLDEILEIDEEWRELKAEGD
1764|gene|hut       --------------MLSRQYVREHPGEVRETLAARGVDDVDLDAILEIDEEWRELKARGD
2073|gene|hla       --------------MLSRQFVRENPEVVREALDNKGV-DVDLDRILDVDEEWRELKSRGD
5200|gene|hbo       --------------MISRQFLRENPETVREALRSKGVDDVDLDHILEVDEEWRSLKKRGD
2072|gene|nrc1      MRYVLAAARRTRTQMLSRQFVREHPEKVRDALDAKGV-DADLDRILEVDEEWRELKARGD
1692|gene|nph       --------------MLSRQFVRENPEEVRRALDTKGV-DVDLDRILDIDEEWRELKAEGD
                                  *:.** :*::*  :* ::  .** ..:** ** :*:***. *  **

3138|gene|hwa       ELRHERNQISSKIGKLKAAGDEDAASEAIAQSQELKNELEEIEREADKLKSELDTAMLKI
12808|gene|hma      GLRQERNEVSSKIGELKQDGKDEEAQEAIDRSQELKDELQDIEERADELESQLEEALLEL
89|gene|hhi         GLRQERNEVSSKIGQLKQDGKDEEAQEAIDRSQELKDELQEVEERADELESRLEKALLEL
1764|gene|hut       DLRHDRNEVSSKIGELKQEGDEEAAQEAIERSQELKDELQEVEERADELERELEERLLEI
2073|gene|hla       DLRHERNEVSSTIGELKQAGEEEAAQEAIERSQEVKSELQEIEERADELEAELEESLLEL
5200|gene|hbo       DLRHERNETSSKIGELKAEGKDEEAQEAIERSQELKSELAEVEDRADELEAELEERLLEL
2072|gene|nrc1      ELRHDRNEVSSKIGELKQAGDEDAAQEAIERSQALKDELADVEARADDLEAELERLLLTL
1692|gene|nph       DLRRQRNEVSSEIGKLKRDGEEEAAAEAIERSQELKEEIEAVEDRADELESELEAALLRL
                     **.:**: ** **:**  *.:: * *** .** :*.*:  :*  **.*:  *:  :* :

3138|gene|hwa       PQVPDDAVPVGTDESENVERRREGFDSLRSLPDTVIPHYDLGEELEILDFERGAKVTGGG
12808|gene|hma      PNIPHESVPTGEGEADNVERYREGFDDLRDLPDEVVPHYDLGEDLDLLDFERGAKVSGGG
89|gene|hhi         PNVPHESVPTGEGEADNVERYREGFDDLRDLPDEVIPHYDLGEDLDLLDFERGAKVSGGG
1764|gene|hut       PNIPQEGVPEGEDESDNVETRRWGFEDLRDLPEDVTPHYDLGEELDILDFERGAKVSGGG
2073|gene|hla       PQIPHESVPVGADESENVERRREGFDDLREVPDNVEPHYDLGEELEILDFERGAKVAGGG
5200|gene|hbo       PQIPHDDVPVGEDESENVERRREGFDDLRELPDEVIPHYDLGEELDILDFERGAKVTGGG
2072|gene|nrc1      PMVPDEDAPVGDSEAENVERRREGFDDRRDLPESVVPHYDLGEELDILDFERGAKVSGGG
1692|gene|nph       PNVPHPDAPVGDDESDNVEIDRWGFDDRRSLPDEVVPHYDLGEELDILDFERGAKVSGGG
                    * :*   .* * .*::***  * **:. *.:*: * *******:*::*********:***

3138|gene|hwa       FYFAKGDGARLEHALVQFMLDIHR-EQGYQDVFPPIPVNSQSMVGTGQFPKFTEDAYRIG
12808|gene|hma      YQFVKGEGARLEHALIQFMLDVHR-EQEYVDVLPPIPVNSDSMEGTGQLPKFAEDAYRVG
89|gene|hhi         YQFVKGEGARLEHALIQFMLDVHR-EQEYVDVLPPIPVNSDSMEGTGQLPKFDEDAYRVG
1764|gene|hut       FYFLKGDAARLEHALIQFMRDIHR-EQGYEEVFPPIPVSSESMTGTGQLPKFADDAYKL-
2073|gene|hla       FYVAKGDGARLEHALIQFMLDVHR-EQDYRDVFPPIAVNSTSMRGTGQLPKFTEDAYRIE
5200|gene|hbo       FYFAKGDGARLEHALIQFMMDVHR-EQGYVDLFPPIPVNSQSMTGTGQFPKFTEDAYRIG
2072|gene|nrc1      FYFSKGAGARLEHALVQFMLDVHR-EQGYEDVFPPMPVSARSMEGTGQFPKFVEDAYRIG
1692|gene|nph       FYFAKGEGARLEHALVQFMLDVHRDEHGYTDVFPPLPVNSASMRGTGQFPKFVEDAYRIG
                    : . ** .*******:*** *:** *: * :::**:.*.: ** ****:*** :***.: 

3138|gene|hwa       ETNDEPWDNDDLWLCPTAEVPVTNMYRDEILLDDDLPVKIQAYTPNFRREAGEHGTETRG
12808|gene|hma      ARQDDDYDSDDLWLLPTAEVPVTNMYRGEILLDDDLPVKHQAFSPNFRREAGEHGTETRG
89|gene|hhi         ARQDDDYDSDDLWLLPTAEVPVTNMYRDEILLDDDLPVKHQAFSPNFRREAGEHGTETRG
1764|gene|hut       -------EEEDLWLCPTAEVPVTNMYRDEILLDDDLPLKHQAYTPNFRQEAGEHGTETRG
2073|gene|hla       GTNEDAYDDDDLWLLPTAEVPVTNLHRDEILLGEDLPLKYQAYTPNFRQEAGEHGTETRG
5200|gene|hbo       KANGKERDDDDLWLCPTAEVPVTNMYRDEILLDDDLPVKHQAYTPNFRREAGEHGTETRG
2072|gene|nrc1      GENDADYDDDDLWLLPTAEVPVTNMYRDEILLDDDLPVKHQAYSPNFRREAGEHGTETRG
1692|gene|nph       GDNDDPYDDDDLWLLPTAEVPVTNMYRDEILLDDDLPLKQQAYSPNFRREAGEHGTETRG
                           :.:**** *********::*.****.:***:* **::****.***********

3138|gene|hwa       IVRVHQFNKVELVNFVRPEDSAERFDGLLTEAEVVLQRLGLPYRILEMCTGDLGFTQRKK
12808|gene|hma      YVRVHQFHKVELVNFVRPENSYDRLESLLDEAAEVLDRLELPYRVLDMCTGDMGFTQAKK
89|gene|hhi         YVRVHQFHKVELVNFVRPENSYDRLESLLDEAAEVLDRLELPYRVLDMCTGDMGFTQAKK
1764|gene|hut       IVRVHQFNKVELVNFVEPEESDERLEGLLDEAEEVLRRLELPYRILELCTGDLTFASAKT
2073|gene|hla       IVRVHQFNKVEMVNFVRPEESHERFEGLVDEAEEVLRRLELPYRILEMCTGDLGFTQAKK
5200|gene|hbo       IVRVHQFNKVEMVNFVRPENSYEQFEELLDEAEEVLRRLELPYRILEMCTGDLGFTQAKK
2072|gene|nrc1      IVRVHQFNKVELVNFVRPEDSAERFHGLLDEAEAVLRRLDLPYRVLEMCTGDMGFTQAKK
1692|gene|nph       IVRVHQFNKVEMVNFVRPENSYDRLEGLLGEATDVLERLGLPYRVLEMCTGDMGFTQAKK
                     ******:***:**** **:* :.:  *: **  ** ** ****:*::****: *:. *.

3138|gene|hwa       YDIEVWAPGDDMATGPDIGGRWLEVSSVSNFGAFQSRRAGLRYRPERHESASYLHTLNGS
12808|gene|hma      YDIEVWAPGDDMEDGPDRGGRWLEVSSVSNFEDFQARRAGLRYRPERHESADYLHTLNGS
89|gene|hhi         YDIEVWAPGDDMADGPDRGGRWLEVSSVSNFEDFQARRAGLRYRPERHESADYLHTLNGS
1764|gene|hut       YDVEVWAPGDDMEEGPTEGGRWLEVSSASNFEDFQARRAGIRYRPERHESAEYLHTLNAS
2073|gene|hla       YDLEVWAPADDMDEGPAEGGRWLEVSSVSNFEEFQARRAGIRYREEHHESAEFLHTLNGS
5200|gene|hbo       YDIEVWAPGDDMEDGPEEGGRWLEVSSVSNFEDFQARRAGLRYRPERHESAEYLHTLNGS
2072|gene|nrc1      YDIEVWAPGDDMDGGPEMGGRWLEVSSVSNFKDFQARRADIQYRPERHESAEHLHTLNGS
1692|gene|nph       YDVEVWAPGDDMEDGPDVGGRWLEVSSVSNFEDFQARRAHIQYRPEQHESAEYIHTLNAS
                    **:*****.***  **  *********.***  **:*** :.** *.****..:****.*

3138|gene|hwa       GVAVPRVMVAIMEYYQNDDGTITIPEPLQPYMNGLSVIEGHDPVGEAAVGAGKRE-
12808|gene|hma      GLAVPRVLVAIMEYYQNDDGTITVPEPLRPYMGGQEVIEGSEKIGESAVGAGEKE-
89|gene|hhi         GLAVPRVLVAIMEYYQNDDGTITVPEPLRPYMGGQEVIEGSEKIGESAVGAGEKE-
1764|gene|hut       GVALPRVLVAILEYYQNDDGTVTVPEALRPYLDGQELIEGQDPVGESALGAGDR--
2073|gene|hla       GLAVPRIVVAILEYYQNDDGTVTVPEALRPYMGGTEVIEGHDAVGETKLGGE----
5200|gene|hbo       GLAIPRVVVAIMEYYQNDDGTVTVPEALRPYMGGTEVIEGHDPVGESAVGAGKKD-
2072|gene|nrc1      GVAVPRVLVAILEYYQNDDGTVTVPEALQPYMNGQTRIEGSRKVGESALGDGDREA
1692|gene|nph       GLAVPRVVVAILEYYQNDDGTVDVPEPLQPYMGGTDVIDGQDPVGESALGE-----
                    *:*:**::***:*********: :**.*.**:.*   *:*   :**: :*