HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0305arCOG01449hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0305 nrc1 VNG1788 vng1788 no entry
cHOG0305 hmu HMUK1538 Hmuk_1538 conserved hypothetical protein
cHOG0305 hma RRNAC1728 hypothetical protein
cHOG0305 hwa HQ3325A hypothetical protein
cHOG0305 hla HLAC2017 Hlac_2017 hypothetical protein
cHOG0305 hbo HBOR07420 Hbor_07420 hypothetical protein
cHOG0305 hut HUTA0202 Huta_0202 conserved hypothetical protein
cHOG0305 hvo HVO_2333 HVO_2333 conserved hypothetical protein
cHOG0305 nph NP4532A hypothetical protein
cHOG0305 hhi 2260 HAH_2260 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1788|chp|nrc1      MLQAEGMQTHVVPVGFDYDRLIAPLVREQLQVDRVILLEGAVGSQANVEYSQRISEKLEQ
2017|hp|hla        ------MQTHIVPVGFDYDRMIAPLIRDQFDVDRVILLEGTVGSEANVEYSRNIARKLEQ
202|chp|hut        ------MQTHIVPVGFDYDRLIAPLVREQRTVDRAILLEGAIGNEANAEYSRLLTSQLEK
3325|hp|hwa        ------MQTHVVPVGFDYDRLIAPLIRDQVDVDRVILLEGAVGSESNVEYSQNLSKKLEK
7420|hp|hbo        ------MQTHVVPVGFDYDRLIAPLIRDQLDVDHVILLEGAIGSEANVEYSQNLSTKLEK
11728|hp|hma       ------MQTHIVPVGFDYDRLIAPLVREQLDVDRVILLEGAVGSEANVEYSRNLAEKLEK
2260|hp|hhi        ------MQTHIVPVGFDYDRLIAPLVREQLDVDRVILLEGAVGSEANVEYSRNLAEKLEK
4532|hp|nph        ------MQTHIVPVGFDYDRLIAPLVRDQLDVDRVILLEGAVGSEANVEYSRNLADKLQK
                         ****:*********:****:*:*  **..*****::*.::*.***. :: :*::

1788|chp|nrc1      DFRNLLGADTDRVSVVDVYDYDAAFEQAFALIDDVLDAD------PDGEVWVNIASMPRT
2017|hp|hla        DFRNLLGAETVREQLDDVYDYDAAFERAFDLINAELDRDEGVDDSDEREVWVNLCSMPRP
202|chp|hut        DFQNLLGSKTERILVEDVYDYDAAFEQGFSLISDELDRD------PDAEVWLNISAMPRT
3325|hp|hwa        DFKNLLGADTNRVVVADVYDYDAAFEQAYDLINDQLDIA------KDAEVWVNVSAMPRP
7420|hp|hbo        DFQNLLGADTERVVIEDVYDYDAAFEQAYDLINTELDKS------DDTEVWVNVSAMPRP
11728|hp|hma       DYQNLLGAETERFVVADVYDYDEAFEQAFELINAELDAG--------SEVWVNVSAMPRT
2260|hp|hhi        DYQNLLGAETERFVVADVYDYDEAFEQAFELINAELDAG--------SEVWVNVSAMPRT
4532|hp|nph        DFTNLLGAETEEYLVEDVYDYDAAFEQAYDLINGELDTG--------SEVWVNVSAMPRT
                   *: ****:.*    : ****** ***..: **.  **           ***:*:.:***.

1788|chp|nrc1      VSFAFATAAHSMMVEQPEDRDRIHTYYTAPEKYLETELAEELRASAALLESVADGD---V
2017|hp|hla        VSFAFATAAHSIMVERQDDRDRIHTYYTAPEKYLETELAEELRANRDLLRELVEDDAVAD
202|chp|hut        VSFAFATAAHSIAVEREGDRHRIHTYYTAPEKYLETELAEELRKQIDLLEDLSDD----V
3325|hp|hwa        VSFAYATAAHSIMVERQADRDRIHTYYTAPEKYLETELAEEVRAAKELLGDILDSSNATE
7420|hp|hbo        VSFAFATAAHSVMVERQADRERIHTYYTAPEKYLETELAEEVRAARDLLGDLLNGAE--L
11728|hp|hma       VSFAFATAAHSIMVEREGDRDRIHTYYTVPEKYLETELAEELRKQIDMLEDMRTGE---E
2260|hp|hhi        VSFAFATAAHSIMVEREGDRDRIHTYYTVPEKYLETELAEELRKQIDMLEDMRTGE---E
4532|hp|nph        VSFAFATAAHSIMVEREGDRDRIHTYYTVPEKYLETELAEELRAQCSLLEDVLEDD---V
                   ****:******: **.  ** *******.************:*    :* .:  .     

1788|chp|nrc1      D---ADAVDERLTAARDLLAEFDERGTTIGAKEIGGSHIVELPVASFSNVKPFEEVILFT
2017|hp|hla        DRVGDDRIAEQLATTTDLLAEFDERGTTIGAKRIGDSHVIELPVASFQNVKPFEELVLFT
202|chp|hut        D---DDLVEKRLGSAQDLIEEFDERGTTIGAKEINGSYMVEIPVASFSNVKPFEELILFT
3325|hp|hwa        F---DQRIRERHQTAADLIEEFDERGTTIGAKPVDGGHIIELPVASFRNVKPFEKIILFE
7420|hp|hbo        D---DDRIRERFESASDLLEEFDERGTTIGAKRIGDEHIVELPVASFSNVKPFEEIILFE
11728|hp|hma       V---DERIDDRLETARDLLSEFDERGTTIGAKEIDGSHVVELPVASFSNVKPFEEVILFT
2260|hp|hhi        V---DERIDDRLETARDLLSEFDERGTTIGAKEIDGSHIVELPVASFSNVKPFEEVILFT
4532|hp|nph        E---DERIEEHLDVARDLLEEFDERGTTIGAKQFGDSHIIELPVASFSNVKPFEELILFT
                        : : ..   : **: ************ ... :::*:***** ******:::** 

1788|chp|nrc1      LGEHGTFESVSELAAALADDLNEEYTDSFRSKVTYTVDKLGPGGKGYVEREEHGKSYRTW
2017|hp|hla        LGEHGEFESVSELAETLAADLNEQYTDSFRSKVIYNVDRLGPGGKGYIEREEHGKSYRTT
202|chp|hut        LGEHGEFESVSELAQALAVDLGEEYTDSFRSKVLYNVDRLGPGGKGYIEQEEHGKSYRTR
3325|hp|hwa        LGEYGEFDSVSELAEMLARDMNEEYTDSFRSKVIYNVDRLGPGGKGYIEQEDRGKSYRTR
7420|hp|hbo        LGEYGQFESVSELAETLARDMNEEYTDSFRSKVIYNVDRLGPGGKGYIEQEEHGKSYRTR
11728|hp|hma       LGEHGEFESVSELAQQLARDLGEEYTDSFRSKVIYNVDRLGPGGKGYIEQEEHGKSYRTT
2260|hp|hhi        LGEHGEFESVSELAQQLARDLGEEYTDSFRSKVIYNVDRLGPGGKGYIEQEEHGKSYRTT
4532|hp|nph        LGEHDEFESVSELAQTLARELGEEYTDSFRSKVIYNVDRLGPGGKGYIEQESHGKSYRTR
                   ***:. *:******  ** ::.*:********* *.**.********:*.*..****** 

1788|chp|nrc1      LSRIGQLWVRAHEN-------------TGTGE
2017|hp|hla        LSRIGELWVRAHAGE------------DRELA
202|chp|hut        LSRIGELWVRAHSGE--------RPDRAPATD
3325|hp|hwa        LSHIGQLWVRAHAEDDDVLAQQVQAETDTYQN
7420|hp|hbo        LSRIGELWVRSHAGAD-------ADELSRAGN
11728|hp|hma       LSRIGQLWVRAHSAED-------REHRESDLP
2260|hp|hhi        LSRIGQLWVRAHSAED-------RKHRESDLP
4532|hp|nph        LSRIGELWVRSHAD-------------ESDL-
                   **.**:****:*