HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0304COG0115KOG0975arCOG02297Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyasebranched-chain amino acid aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0304 nrc1 VNG0387 ilvE1 branched-chain amino acid aminotransferase
cHOG0304 hmu HMUK2928 Hmuk_2928 aminotransferase class IV( EC:2.6.1.42 )
cHOG0304 hma RRNAC0711 ilvE2 branched-chain amino acid aminotransferase
cHOG0304 hwa HQ1247A ilvE branched-chain amino acid aminotransferase
cHOG0304 hla HLAC0461 Hlac_461 aminotransferase class IV
cHOG0304 hbo HBOR25080 Hbor_25080 branched chain amino acid aminotransferase apoenzyme( EC:2.6.1.42 )
cHOG0304 hut HUTA2483 Huta_2483 aminotransferase class IV
cHOG0304 hvo HVO_0708 HVO_0708 branched-chain amino acid aminotransferase
cHOG0304 nph NP0798A ilvE_2 branched-chain amino acid aminotransferase 2
cHOG0304 hhi 1359 ilvE2 branched-chain amino acid aminotransferase
MUSCLE (3.6) multiple sequence alignment


387|gene|nrc1       --------------MRYHVNGALVDAADATVSVRDRGFQYGDAAFETMRAYGGQTFAWTA
798|gene|nph        --------------MYYHVDGDLVDREDATVHVDDRGFRYGDAAFETCRAYGGEVFLWDR
2483|gene|hut       --------------MEYHVDGELVPAEEASVNVRDRGFMYGDAAFETLRAYGGEVFAWDA
10711|gene|hma      --------------MQYHVNGTLVPEDEATVSVRDRGFMYGDAAFETLRAYGGEPFRWDA
1359|gene|hhi       --------------MQYHVDGDLVPEDEATVSVRDRGFMYGDAAFETLRAYGGEPFRWDA
461|gene|hla        MGEDPGGADDAAEELRYHVDGEIVPASQATVSVEDRGFAYGDAAFETLRAYGGEVFRWDD
1247|gene|hwa       MSRDRSTSDSP---SYAHVDNELVPMEDATVSIRDRGFMYGDGVFETLRAYGGEVFRWKA
25080|gene|hbo      -MTENDTGGDSADELRFHVNGELVRASEATVNVRDRGFMYGDALFETLRAYGGDIFRWEA
                                     **:. :*   :*:* : **** ***. *** *****: * *  

387|gene|nrc1       HYRRLQATCDSLGIDHGLS-EAALRGRVHETLAANDLADAYVRLSITRGVQDGRLTPRDT
798|gene|nph        HRERLAETCRLLGMAEAVP--EDLQGRIDETLQANGYADAYIRVSVSRGVQSGKLTPGPA
2483|gene|hut       HADRLERTCETLGFARAIPPRADLRERIAETLAANDLTDAYVKLSISRGVQAGKLTPDPA
10711|gene|hma      HRERLQRTAETLGFADAVP--EDLGERVDETLAANDLEEAYVRLSVTRGVQPGKLTPGAD
1359|gene|hhi       HRDRLQRTAETLGFADAVP--GDLRERVDETLAANDLDEAYVRLSVTRGVQPGKLTPGSD
461|gene|hla        HAARLADTCETLGLDHGLS-EIDLKARIDETLAANDLAEAYVKLSITRGVQPGTLDPRPE
1247|gene|hwa       HANRLADSASAINLEHGLS-QATLKNRIDETLTANNLDEAYVKLSITRGVQPGKLNPDPT
25080|gene|hbo      HANRLAEGAEILELDHGLS-NAELKRRVDETLAANELSDAYVKLSVTRGVQPGKLNPDPE
                    *  **   .  : :  .:.    *  *: *** **   :**:.:*::**** * * *   

387|gene|nrc1       TDPTVVVVVDALPRGGVDGDPVWSMPATVETTTVTQHRDTTIPSTAKTHNYLPGVLARRD
798|gene|nph        TDPTVVVYAKPLPRGGGDGENCWETDATVHTVETRRPPESVLPSAAKTHNYLNGILARIE
2483|gene|hut       VDPTIVVIVDSLPRGGIDGDPVWDDPATVRTVETRKIPDAALPADTKTHNYLNGILARLE
10711|gene|hma      VDPTVVVICKELPRGGLDGERVWDEPASAQTVRTRRIPSEAVPADAKTHNYLNGILGRLE
1359|gene|hhi       VDPTVVVICKGLPKGGLEGGRVWDEPASVQTVRTRRIPSEAVPADAKTHNYLNGILGRLE
461|gene|hla        VDPTVVVIAKPLARGGVDSTPVHDGPAALQTTKTRKPSSRALPADAKTHNYLNGILARLE
1247|gene|hwa       VDPTVVVQTSPLPRGGINSNPVWDDPATLQTVKTRRIPDRALPSHAKTHNYLNGILARAE
25080|gene|hbo      VDPTVVIQVKPLPRGGRGSDPVWDAPATLQTVKTRRVPDRAIPSRAKTHNYLNGILARLE
                    .***:*:  . *..**  .   ..  *:  *. . .  . .:*: :****** *:*.* :

387|gene|nrc1       IAADA------DEALFVTPDGHLTEGAASNLFFVADGTLYTPSGDLDVLPGITRWAVAEL
798|gene|nph        LRGTAA-----DEALMCDTEGAVAEGATSNVFFVEEGTLKTPA-KGALLPGITRATVLSL
2483|gene|hut       LQQEAS-GDPADEALLLDTDGYLAEGATSNLFFVADGVVHTPTTDQPILPGVTRSIVLDL
10711|gene|hma      LRKAAAGGEPADECLIRDTDGNLAEGATSNLFFVTDNGLRTPSTDLDLLPGVTRDVVMDI
1359|gene|hhi       LRKAAAGGEPADECLIRDTDGNLAEGATSNLFFVTDNGLRTPSTDLDLLPGVTRDVVMDI
461|gene|hla        LRVTGA-----DEALMLDPDGNVAEGATANLFFADGTALKTPSLDGPILPGVTRRTVIEI
1247|gene|hwa       LRVSDA-----DEAVMLDTDGQLAEGATGNIFFVDGDALCTPSLDGPVLPGITRSTVLDI
25080|gene|hbo      LRVTDA-----DEAVMLDGDGALAEGATSNLFFVRNNALHTPSLDGPVLPGITRAEVLDI
                    :          **.::   :* ::***:.*:**.    : **: .  :***:**  * .:

387|gene|nrc1       AAEHGLTVHTGAYTPSRLYDADEAFLTNTTWEVRPIARVDDATYDT------CRIGAALA
798|gene|nph        AESEGIPVEEGRYRPADIEAADEAFLTNTTWEVRPIATVDGTTVGG------GETTRRLS
2483|gene|hut       AREEGLPVETGPYERDDLLAVDEAFLTNTTWELRPVGAVDGESIGG------GPITRLLS
10711|gene|hma      ARGEDFPVETGHYSLDALRDADEAFLTNSTWEIRPIATVDGISVGS------GPMTKLLQ
1359|gene|hhi       ARGEDFPVETGHYSLDALRDADEAFLTNSTWEIRPVSTVDGISVGS------GPMTKLLQ
461|gene|hla        AEAEGIPVEEGTYAPDAVREADEVFLTNSTWEIRPVETVDGIGVDGDGEGVEGPLTALLS
1247|gene|hwa       AAEEGIPIREDSFDINTLREAEEAFVTNTTWEIRPVKTIDGIDIGR------GPLTTLLQ
25080|gene|hbo      ARDEGIPVREGRYKPDDLRDATEAFVTNSTWELRPVASVDGIELGG------GPVTTLLS
                    *   .:.:  . :    :  . *.*:**:***:**:  :*.   .             * 

387|gene|nrc1       SAYNAEIERRHY----------
798|gene|nph        RAYDELVETRCY----------
2483|gene|hut       RLYDRRVERSCYE---------
10711|gene|hma      RLFDERIEERHY----------
1359|gene|hhi       RLFDERIEERYY----------
461|gene|hla        RLFDRRVEEAYYDGERL-----
1247|gene|hwa       QAFQNRVEKRYYDTHREVPNEE
25080|gene|hbo      RLFDARVEQRHYTE--------
                      ::  :*   *