HOG Organism Gene ID Name Annotation
aHOG3019 nrc1 VNG0501 yfmO1 multidrug resistance protein homolog
>501|gene|nrc1
MVPRAHMYNLSGSLLGPSPSPHGMGFRDFHPAVLATALATFIAFLGIGVVDPILPSIAKE
LGADHFMVMFLFTSYLLVTGLANLVAGTLATRIGSKNTMLVGIGIVAVFAGGCALVSSVE
SMAVLRGFWGLGNALFTTTALAIIVGVSAGNSGRAITLYEAALGFGIACGPLLGGFLGAQ
SWRLPFAGTSVLMLLGFVFVATTVTEPDTEGREGVRALIGTFRHTGVRTNAIVGMLYTYG
FFTVLAYTPLVLEGFTTMQIGLVFFAWGLLVIVGSAVLAPRLNARFGTPEVASAALTAFA
ALLCLMWLVSSPMVLAGLVVTAGLACGLLNANLSTLAMGISTHSRPSASGAYNSLRFTGG
AFAPIVAGYIGGNYGAALPFLLGAAVITLGLIVLLARFSAFTFATPDAVGDH