HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0300COG1204KOG0952 KOG0951arCOG00553Superfamily II helicaseDNA repair protein

HOG Organism Gene ID Name Annotation
cHOG0300 nrc1 VNG2368 rad24b DNA repair protein
cHOG0300 hmu HMUK0689 Hmuk_0689 DEAD/DEAH box helicase domain protein( EC:3.6.1.- )
cHOG0300 hma RRNAC2876 rad24-2 ski2-like helicase
cHOG0300 hwa HQ1008A mer3 ski2-like helicase
cHOG0300 hla HLAC2702 Hlac_2702 DEAD/DEAH box helicase domain protein
cHOG0300 hbo HBOR02230 Hbor_02230 superfamily II helicase( EC:3.6.1.- )
cHOG0300 hut HUTA2129 Huta_2129 DEAD/DEAH box helicase domain protein
cHOG0300 hvo HVO_0014 HVO_0014 RNA helicase Ski2 homolog
cHOG0300 nph NP0492A mer3_1 ski2-like helicase
cHOG0300 hhi 2461 HAH_2461 DEAD/DEAH box helicase domain-containing protein
cHOG0300 hhi 145 HAH_0145 ski2-like helicase
MUSCLE (3.6) multiple sequence alignment


2461|gene|hhi       MTENSPAEAEFFNSTIDKLIEELLKNDLGVPYSTLYPVTDEELHRSVWLASYLANSDDEN
1008|gene|hwa       ---MEPDDVS------------------GLP---------------PGVSDKLRTE----
2702|gene|hla       ---MQPSSLS------------------GLP---------------AGVGEALEAE----
2230|gene|hbo       ---MKPEDVP------------------GLP---------------EGVPEQLQSE----
2368|gene|nrc1      ---MRVADVP------------------GLP---------------GGVADHFEGE----
492|gene|nph        ---MDVSEVS------------------GVP---------------PWFADHLREE----
2129|gene|hut       ---MDVADIP------------------GVP---------------AWLPEHLQAE----
12876|gene|hma      ---MDVADLP------------------GVP---------------EWLPDHLRDD----
145|gene|hhi        ---MDVADLP------------------GVP---------------EWLPDHLRDD----
                           .                    *:*                 . . :  .    

2461|gene|hhi       DRKKALALATLSYIRNKNSPDKSVYKQYLYIVLSRLGNLPAFENVRDEEGGEIQGSDSYE
1008|gene|hwa       ------------------------------------------------------------
2702|gene|hla       ------------------------------------------------------------
2230|gene|hbo       ------------------------------------------------------------
2368|gene|nrc1      ------------------------------------------------------------
492|gene|nph        ------------------------------------------------------------
2129|gene|hut       ------------------------------------------------------------
12876|gene|hma      ------------------------------------------------------------
145|gene|hhi        ------------------------------------------------------------
                                                                                

2461|gene|hhi       NNGHIQTNSFETGIFNSYDPILNAELQTSKQEYQIDRDTVLSAFQNEIYDSLNKGKDVAI
1008|gene|hwa       ------------GVTELYPP----------QESAVKA-------------GLTDGESLVA
2702|gene|hla       ------------GVAELYPP----------QEAAVEA-------------GVADGESLVA
2230|gene|hbo       ------------GIEELYPP----------QADAVEA-------------GVTEGESVLA
2368|gene|nrc1      ------------GVEELYPP----------QAEAVER-------------GVTEGANLVA
492|gene|nph        ------------GIESLYPP----------QAAAVDA-------------GVADGESLVA
2129|gene|hut       ------------GIEELYPP----------QAEAVEG-------------GVTDGANLVA
12876|gene|hma      ------------GIEELYPP----------QAEAVEA-------------GVTEGENLVA
145|gene|hhi        ------------GIEELYPP----------QAEAVEA-------------GVTEGENLVA
                                *: . * *          *   :.              .: .* .:  

2461|gene|hhi       SGPTSSGKSFIIREYINSKISEQ----------------NKFDTIYVVPTKALISEVCRK
1008|gene|hwa       SVPTASGKTLIAELAMLAAIERG------------------ETALYIVPLRALASEKQTE
2702|gene|hla       AVPTASGKTLIAELAMLSSIERG------------------GKALYIVPLRALASEKKTE
2230|gene|hbo       SIPTASGKTFIAELAMLSSVQRG------------------GKALYIVPLRALASEKKAE
2368|gene|nrc1      SVPTASGKTLIAQLAMLSAIAEG---------GDSPTFSGDGTALYIVPLRALAGEKAQE
492|gene|nph        SVPTASGKTLVAQLAMLSAIDRG------------------GTALYIVPLRALASEKREE
2129|gene|hut       SVPTASGKTLIAELAMFSAITDGEGDEAGDDEGVDHAAETDGTALYIVPLRALASEKRTE
12876|gene|hma      SIPTASGKTLIAELAMLSSVARG------------------GKALYIVPLRALASEKQAD
145|gene|hhi        SIPTASGKTLIAELAMLSSVARG------------------GKALYIVPLRALASEKQAD
                    : **:***:::    : : :                       ::*:** .** .*   .

2461|gene|hhi       LSERFPDASIETGAHFT--ETNEEKNNETTFLVVTPERCLNLLSEENRSSISPSLVFFDE
1008|gene|hwa       F-ERWEEFGVDIGVSTGNYDSSGEWLASRDIIVATSEKVDSLIRNDAPWINQLGCVVADE
2702|gene|hla       F-ERWEEFGVTVGVSTGNYESDGEWLATRDIIVATSEKVDSLIRNGAPWIDDLTCVVSDE
2230|gene|hbo       F-ERWEEFGIDVGVSTGNYDSSGEWLASRDIIVATSEKVDSLIRNNAPWVEDLSCVVSDE
2368|gene|nrc1      F-EAFERFGLSVGVSTGNYERDGARLADNDIVVATSEKVDSLVRNGAGWIDDLSCVVADE
492|gene|nph        F-AAFEEYGLSVGVTTGSYEDTGEWLADKDIIVATSEKVDSLVRNGAPWIDDLDCVVADE
2129|gene|hut       F-EQFEAYGLEVGVSTGNYESDGGWLGDKDVVVATSEKVDSLVRNDAPWIDDLDCVVADE
12876|gene|hma      F-EEFEQYGLDIGVSTGNYESEGGWLADKDIVVATSEKVDSLVRNDAPWIEDLTCVVTDE
145|gene|hhi        F-EEFEQYGLDIGVSTGNYESEGGWLADKDIVVATSEKVDSLVRNDAPWIEDLTCVVTDE
                    :   :   .:  *.     :    .     .:*.*.*.  .*: :      .   *. **

2461|gene|hhi       IQNLESGERGVIFESIIESLTTYWPRAQIVAAGPYLKNSGVTLSSLTDRDVKEIETKFAP
1008|gene|hwa       VHLVNDRTRGPTLEVTLGKLRQRNTALQVVALSATIGNADAIAEWL---DASLVDTDWRP
2702|gene|hla       VHLVDDPNRGPTLEVTLAKLRKVNPGLQTVALSATVGNADVIAEWL---DAELVESDWRP
2230|gene|hbo       VHLVNDGHRGPTLEVTLGKLRKINPGLQVVALSATVGNADDVAAWL---DATLVESEWRP
2368|gene|nrc1      VHLVDDDHRGPTLEVTLAKLRQQVADLQVVALSATVGNAGELAAWL---DAELVDSDWRP
492|gene|nph        VHLVDDEHRGPTLEVTLAKLRRVNPNLQVVALSATVGNAGEMAEWL---DAELVDSSWRP
2129|gene|hut       VHLVDDGERGPTLEVTLAKLRKRNPDLQTVALSATIGNADALAEWL---DAELVDSTWRP
12876|gene|hma      VHLVDDGERGPTLEVTLAKLRRLNPDLQTVALSATIGNAEALATWL---DAGLVDSDWRP
145|gene|hhi        VHLVDDGERGPTLEVTLAKLRRLNPDLQTVALSATIGNAEALATWL---DAGLVDSDWRP
                    :: ::.  **  :*  : .*    .  * ** .. : *:      *   *.  ::: : *

2461|gene|hhi       VLQLKAILEFQRGGGNAPGQRLMNATIYSPSGEPLTTKVPEPEQVTFSDFNDNKKNSLPH
1008|gene|hwa       I-------ELQIG---------------VHYGNAITFDDATQQRVP---VANGERQTPAL
2702|gene|hla       I-------DLRMG---------------VHFGNAIDFADGSKREVP---VERGEDQTARL
2230|gene|hbo       I-------DLKMG---------------VHYGNAISFDDGTQREVP---VGKGDRKTAAL
2368|gene|nrc1      I-------ELRTG---------------VHYGQSLHYDDGTQAELS---VGSGS-QTAAV
492|gene|nph        I-------ELRKG---------------VHYGQALHFGDGTQQELP---VQRTEKPTEAV
2129|gene|hut       I-------DLKKG---------------VHYGQALQFEDGSQQELR---VHDNEKATAAI
12876|gene|hma      I-------DLQKG---------------VHYGQALHLEDGSQQRLS---VQNNEKQTAAI
145|gene|hhi        I-------DLQKG---------------VHYGQALHLEDGSQQRLS---VQNNEKQTAAI
                    :       ::. *                  *:.:         :    .   .  :   

2461|gene|hhi       ILDEFASN----------------------------------------------------
1008|gene|hwa       VADTLAGDSED-------------------------------------------------
2702|gene|hla       VADALDTEEDG-------------------------------------------------
2230|gene|hbo       VADTLEED----------------------------------------------------
2368|gene|nrc1      VADTLADD----------------------------------------------------
492|gene|nph        VRETLDEG----------------------------------------------------
2129|gene|hut       LRDTLSSEIQDLAQVPKNKRNLIKETLDGTFDPQVEYQQSIKEEIQNLCIDPLQYDIGEE
12876|gene|hma      VRDTLEDD----------------------------------------------------
145|gene|hhi        VRDTLEDD----------------------------------------------------
                    : : :                                                       

2461|gene|hhi       ------------------------------------------------------------
1008|gene|hwa       ------------------------------------------------------------
2702|gene|hla       ------------------------------------------------------------
2230|gene|hbo       ------------------------------------------------------------
2368|gene|nrc1      ------------------------------------------------------------
492|gene|nph        ------------------------------------------------------------
2129|gene|hut       FGIFGIAITHDIGSAEDIAVRLSEDTTAFVSSSERDTLNEVAKEVQAAGNSRSVQKLSEL
12876|gene|hma      ------------------------------------------------------------
145|gene|hhi        ------------------------------------------------------------
                                                                                

2461|gene|hhi       ----------------------------------------------------SKNIIYAS
1008|gene|hwa       --------------------------------------------------DQGSTLVFVN
2702|gene|hla       --------------------------------------------------QGGSSLVFVN
2230|gene|hbo       ----------------------------------------------------GSSLVFVN
2368|gene|nrc1      ----------------------------------------------------GSTLVFVN
492|gene|nph        ----------------------------------------------------GSTLVFVN
2129|gene|hut       IPTGVGFYHGKLPEKCRRRVKELANDGLLKSIVSTTSLDLDNVDNTNTFHEGGSLLVFVN
12876|gene|hma      ----------------------------------------------------GSTLVFVN
145|gene|hhi        ----------------------------------------------------GSTLVFVN
                                                                        .. :::..

2461|gene|hhi       RRDFAEDRATKIAE---NRKNTADSEDIDDLVQFLRDSIHEEYS--LANCVESGLAYHHG
1008|gene|hwa       SRRNAESAARRLCDVTTSALTEKEQASLAEIAASIREVSDTETSETLATCVEKGAAFHHA
2702|gene|hla       SRRNAESSARKLTDVTGPRLTDDERDQLRELADEIRSGSDTDTASDLADAVEQGSAFHHA
2230|gene|hbo       SRRNAEAAAKRLKDVTSRALTDEERSKLAELAQEIRDVSDAETSDTLANCVAKGAAFHHA
2368|gene|nrc1      SRRNAEASARRLADVTGNALSSAERERLADIAAEIRGVSDTETSDELADAVASGAAFHHA
492|gene|nph        SRRNAEGAAKRLAKTTVDGLDADERAALSSLAEEIRAVSDTETSDDLADCVEQGAAFHHA
2129|gene|hut       SRKNAEAAARRLASTTDPLLSGDERDRLAEIAAEIRDVSDTETSDDLADAVEGGAAFHHA
12876|gene|hma      SRRNAEAAAGRLANTVRPHLSTEERDQLADIAEEIRDVSDTETSDDLADAVADGAAFHHA
145|gene|hhi        SRRNAEAAAGRLANTVRPHLTAEERDQLADIAEEIRDVSDTETSDDLADAVADGAAFHHA
                     *  **  * .: .         :   : .:.  :*     : :  ** .*  * *:**.

2461|gene|hhi       MVPKIAREEIERIYREEDSLDTIVSTPTLLQGVSLPAEKIFLV------GDKKGQDDLTS
1008|gene|hwa       GLAAEHRSLVEDAFRDR-QLKCIAATPTLAAGVNTPSRRVIVRDWRRYDSEYGGMKPLDT
2702|gene|hla       GLRSEDRARVEDAFRDR-LIKCISATPTLAAGVNTPARRVIVRDWRRYDGEFGGMKPLDV
2230|gene|hbo       GLAAEHRSLVEDAFRDR-LVKTVSATPTLAAGVNTPSRRVIVRDWRRYDGEFGGMKPLDV
2368|gene|nrc1      GLAREHRELVEEAFRDR-LVKAVSATPTLAAGVNTPARRVVVRDWQRYDGTAGGMQPLDV
492|gene|nph        GCSSEHRSLVEDAFRDR-LIKTICATPTLAAGVNTPARRVVVRDWRRYSGDAGGMQPLSV
2129|gene|hut       GLSREHRSLVEEAFQER-LVKVISATPTLAAGVNTPSRRVVVRDWRRYDGTAGGMQPLSV
12876|gene|hma      GLSRGHRELVEDAFRDR-LVKVVCATPTLAAGVNTPSRRVVVRDWRRYDGSAGGMAPLSV
145|gene|hhi        GLSRGHRELVEDAFRDR-LVKVVCATPTLAAGVNTPSRRVVVRDWRRYDGSAGGMAPLSV
                          *  :*  :.:   :. : :****  **. *: .:.:       .   *   *  

2461|gene|hhi       FDFNNLIGRVGRLDTKLYGSIYCITTEDDEWAQEQFENAEEKEVEPVTENALNRPDELID
1008|gene|hwa       LEVHQMMGRAGRPGLDPYGEAVLLAGDTET-RDELFDRYIDADLESVRSKLASEPALRTH
2702|gene|hla       LEVHQMCGRAGRPGLDPYGEAVLLANDADT-KEELFERYLWADPEPVRSKLAAEPALRTH
2230|gene|hbo       LEVHQMMGRAGRPGLDPYGEAVLLAKDSDT-RDELFERYIWADAEPVRSKLAAEPALRTH
2368|gene|nrc1      LEVHQMFGRAGRPGLDPYGEAVLLANSHDE-LEELFDRYVYADPEPVRSKLAAEPALRTH
492|gene|nph        LEVHQMMGRAGRPGRDPYGEAVLLADSHDE-LDELLDRYVWADPEPVESKLAREPSMRTH
2129|gene|hut       LEVHQMMGRAGRPGLDPYGEALLLASSHDE-LDELFERYVWADPEPVQSKLAAEPALRTH
12876|gene|hma      LEVHQMMGRAGRPGLDPYGEAVLIASSHDE-VDELFERYVWADPEPVRSKLAAEPALRTH
145|gene|hhi        LEVHQMMGRAGRPGLDPYGEAVLIASSHDE-VDELFERYVWADPEPVRSKLAAEPALRTH
                    ::.::: **.** . . **.   :: . :   :* ::.    : *.* .:    *     

2461|gene|hhi       TL---------TKENIIEEDDGSLRYTG---ILLRNRFLRDPDSVDRYLEENGVNQNDRE
1008|gene|hwa       ALATIATGFARSRTELLAFLKETLYATQ---TDTNGRLKTVTDTVLDYLKRNEFIMQD--
2702|gene|hla       VLATVASGFASTRDGLLSFLDNTLYATQ---TDDEGRLAAVTDTVLDYLAVNDFIERDRD
2230|gene|hbo       LLATIASGFAHTREGLLDFLDQTLYATQ---TDEPGRLEQVTDNVLQYLEANGFIERE--
2368|gene|nrc1      VLAAIATGFTTTEDGLHEFLGGTLYATQ---TDDTGRLRSVTGDVLRYLDRNGFVERD--
492|gene|nph        LLATVASGFADSRSALLSFLDRTLYATQYRHGDGEDNLERVVDTTLSYLETNGFIDRD--
2129|gene|hut       ILSTVASGFANSRAGLLDFLEATLYASQ---TTEGGRLETVVDEVIAYLEANDFLTREDD
12876|gene|hma      ILATVASGFARSRKGLLEFLEQTLYASQ---TDDSGQLERVVDDVLTYLQRNDFLEIE--
145|gene|hhi        ILATVASGFARSREGLLEFLEQTLYASQ---TDDSGQLERVVDDVLTYLQRNDFLEIE--
                     *         :   :      :*  :        ..:    . .  **  * .   :  

2461|gene|hhi       KIRFVLEETLKSIEIPKEIAKKSPTTDPILQNQLYKQVKENPTDWIV-------------
1008|gene|hwa       ------GETLSATGLGHTVSRLY--LDPMSAATIIDGLRWAEKNKTTQ------RSALQD
2702|gene|hla       G----GSESLTATGIGHTVSRLY--LDPMSAAEMIDGLRSVARDAADT-----GASAEAD
2230|gene|hbo       ------DEQLTATGIGHTVSRLY--LDPMSAAEIIDGLRWGADHREEKLRALEGIAPEPE
2368|gene|nrc1      ------GAALRATATGQLVSRLY--VDPMSAATIIDGLRDAARDATE-------------
492|gene|nph        ------GDAIEATDLGHTVSRLY--LDPMSAAEIIDGLADAAS-----------------
2129|gene|hut       P-----DGTLRATSIGQTVSRLY--LDPMSAAEMLDGLREFERTAGER------STRSPH
12876|gene|hma      ------AGELDATSLGHTVSRLY--LDPMSAAEIVDGLRDWERGASDS------TSASGS
145|gene|hhi        ------GGELDATSLGHTVSRLY--LDPMSAAEIVDGLRDWERGASDS------TSASGS
                             : :    : ::.     **:    : . :                      

2461|gene|hhi       ----------AKGRGG----FS-----------------------------------YEK
1008|gene|hwa       NST-------EQATGS----FQPASELVNSKHDTHQDSDE------STVRYPTALGLYHL
2702|gene|hla       NGEFVRTGDADDASGGDEPGFGTYTRAGDDESGERETENEETDEEETEASEVTPLGLYHL
2230|gene|hbo       TANTSR----ETEEAAEASGFQRASEMVDADGGVGDKDGEDMEPIETDRTYPTALGLFHL
2368|gene|nrc1      ----------TDDEGA----FRPASELGDDAALPADASVE-----------PTPLGLYHL
492|gene|nph        ---------------------------------------------------PTAMGLYQL
2129|gene|hut       DGE-------RDDEPP---GFEPASELVSDAGDDIGESDD-----TDDTPQPTAMGLYHL
12876|gene|hma      PAD-------AQAEPPANSGFTTASELAEDAD-ESDADRD-----PDDI---SALGLYHL
145|gene|hhi        PAD-------APAEPPADSGFTTASELAEDADGSDDADAD-----PDDI---SALGLYHL
                                                                             :  

2461|gene|hhi       LEKICKELNRIFKFTYDRSNGIDPPENEAENQIGPIIFAANQ-----WLQGKSYKRMVQN
1008|gene|hwa       VCRT-PDMYELYLKSGDKERFTQVCYEREAELLGRTPSEYDDVRFESWLSALKTGRLLED
2702|gene|hla       ISRT-PDMYELYLKSGDRETYTELCYERETEFLGDVPSEYEDVRFEDWLASLKTARLLED
2230|gene|hbo       VSRT-PDMYQLYLKSGDRETYTEECYEREPELLGKTPSEYEDVRFEEWLSALKTARLLED
2368|gene|nrc1      VSRT-PDMYELYLRSGDREQYTEVAYEHEDELLGATPRE-EQAEFEDWLSALKTARLMAD
492|gene|nph        VART-PDMYELYLRSGDREEYTMLAYEREAELLGELPSEFEEGRFEDWLSALKTARMLED
2129|gene|hut       VSRT-PDMYELYLRSGDEEEYSMEAYEREAEFLGAMPSEFEEGRFEDWLSALKTARLLED
12876|gene|hma      VSRT-PDMYQLYLRSGDREEYEMELFEREEELLGPTPSEFEEGRFEDWLSALKTARLLED
145|gene|hhi        VSRT-PDMYQLYLRSGDREEYEMELFEREDELLGPTPSEFEEGRFEDWLSALKTARLLED
                    : .   ::  ::  : * .       :   : :*      ::     ** . .  *:: :

2461|gene|hhi       RIDSDAVDDKGVNDSISNLFELVDNDIQFVLVKYFSILVKVLESL-------DRDDTQWM
1008|gene|hwa       W--ADETSE----DQITEQYDVGPGDIR-GKVDTASWLLGAAEQLAGEL---GMKTKP-I
2702|gene|hla       W--VNEVDE----DRITERYGVGPGDIR-GKVDTAEWLLRAAETLARDVEGVDGDVVVAV
2230|gene|hbo       W--ASEVDE----DRITERYGVGPGDIR-GKVETAQWLLGAAERLAGEL---DLSATVAV
2368|gene|nrc1      W--ASELDE----ERIAERYDVGPGDIR-GKVETAEWLLNAAERLAGEL---DVECGPAV
492|gene|nph        W--ASELDE----DDIAERYGVGPGDIR-GKVDTAEWLLGAAESLASEQ---DLADVSAI
2129|gene|hut       W--ADEVEE----GTITERYGVGPGDIR-GKVETASWLLNAAERLAGEV---GLDVTPAI
12876|gene|hma      W--ATEVDE----ATITDRYGVGPGDIR-GKVETAQWLLGAAESLASEV---DLDAARAI
145|gene|hhi        W--ATEVDE----ATITERYGVGPGDIR-GKVETAQWLLGAAESLASEV---DLDAARAI
                    .      .:      *:: : :  .**.   *.  . *: . * *       .      :

2461|gene|hhi       QKFDQMLDLGTMDTNEITLITKGVDRSVAVDVYIPSNVDDVTQYLNSNKDKI--------
1008|gene|hwa       ADARRRVEDGVRAELLDLVDIRGVGRKRARRLF-DTGIQDSADLQTAEKKTILRALRGRR
2702|gene|hla       REARKRIEYGVREELLDLAGVRNVGRKRARRLF-EAGIETRADLREADKAVVLGALRGRE
2230|gene|hbo       REAKKRVEYGVRDELLNLAGVRGVGRKRARRLF-EAGIETRNDLREADKSVVLAALRGRR
2368|gene|nrc1      REARKRVQYGVREELLGLAGVRNVGRKRARRLY-NAGVESRADLRNADKGVVLGAVRGRA
492|gene|nph        REARKRVEHGVGEELIDLAGVRGVGRKRARRLY-DAGIETRADLRNADKSVVLAALRGRE
2129|gene|hut       REARVRVEHGVRAELVDLAGVRGVGRKRARRLF-AAGIESREDLREADKAVVLGALRGRE
12876|gene|hma      SEARIRVEHGVREELVDLAGVRGVGRKRARRLF-QAGITDRAQLRDADKAVVLAALRGRR
145|gene|hhi        SEARIRVEHGVREELVDLAGVRGVGRKRARRLF-QAGITDRAQLRDADKSVVLAALRGRR
                     .    :: *.          ..*.*. *  ::  :.:    :   ::*  :        

2461|gene|hhi       --------------PDFYETH---------------------------------------
1008|gene|hwa       KTAERILENAGRTDTSMDSVDEVPNDSTNSDTGN-ETQSNTGGGATTEG---------TR
2702|gene|hla       RTAERILEHAGREDPSMDDVR--------PDKS--ASAAATAGSA---S---------DE
2230|gene|hbo       KTAENVLEAAGRRDPSMDDVQEASADAM-PEATFERASRRSGGESDRGGGGGSGDGNDGE
2368|gene|nrc1      ATAERILETVGHPDPGMDGVA--------ADT---DAAPESGGEA---G---------GD
492|gene|nph        QTAENVLEAAGHQQPEMDGVT--------PDA---DVK-ESAAAA---G---------TD
2129|gene|hut       KTAENILTNAGHRDPSMDGVT--------PAAGSDELTAANGAGS---G---------DR
12876|gene|hma      KTAENVLENAGHRDPSMEGVE--------PAP---DVSVDLNDGA---D---------GD
145|gene|hhi        KTAENVLENAGHRDPSMEGVE--------PAA---DVSVDLDDEA---D---------TD
                                  . :  .                                        

2461|gene|hhi       -----------LKKQGILK
1008|gene|hwa       QGRDIDNQDGNQAGLGDFS
2702|gene|hla       DGEG-------QASLGDFR
2230|gene|hbo       KNGDGADDPQEQASLGDFG
2368|gene|nrc1      EG---------QASLGDFS
492|gene|nph        DG---------QANLGDF-
2129|gene|hut       DGAE-DEQPADQSSLGDF-
12876|gene|hma      ASAE-STANDDQASLGDF-
145|gene|hhi        TNAE-AAANEDQSSLGDF-
                                   * :