HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0030COG0534KOG1347arCOG01731Na+-driven multidrug efflux pumpDNA damage-inducible protein

HOG Organism Gene ID Name Annotation
cHOG0030 nrc1 VNG0720 dip2 DNA damage-inducible protein
cHOG0030 nrc1 VNG2404 dip1 DNA damage-inducible protein
cHOG0030 hmu HMUK0686 Hmuk_0686 MATE efflux family protein
cHOG0030 hma RRNAC2783 dip2 DNA damage-inducible protein
cHOG0030 hma RRNAC2867 dip1 DNA damage-inducible protein
cHOG0030 hwa HQ1850A norM sodium-driven multidrug efflux pump
cHOG0030 hla HLAC0998 Hlac_998 MATE efflux family protein
cHOG0030 hbo HBOR23120 Hbor_23120 putative efflux protein, MATE family
cHOG0030 hbo HBOR02070 Hbor_02070 putative efflux protein, MATE family
cHOG0030 hut HUTA1541 Huta_1541 MATE efflux family protein
cHOG0030 hut HUTA1672 Huta_1672 MATE efflux family protein
cHOG0030 hvo HVO_0913 HVO_0913 dip DNA damage-inducible protein
cHOG0030 nph NP3606A multidrug efflux protein norM-like protein
cHOG0030 nph NP5292A multidrug efflux protein norM-like protein
cHOG0030 hhi 142 dip1 DNA damage-inducible protein
cHOG0030 hhi 68 dip2 DNA damage-inducible protein
MUSCLE (3.6) multiple sequence alignment


2404|gene|nrc1      ------------------------------------------------------------
2070|hp|hbo         ------------------------------------------------------------
1541|gene|hut       ------------------------------------------------------------
12867|gene|hma      ------------------------------------------------------------
142|gene|hhi        ------------------------------------------------------------
12783|gene|hma      ------------------------------------------------------------
68|gene|hhi         ------------------------------------------------------------
1672|gene|hut       -----------------------------------------------------------M
720|gene|nrc1       ------------------------------------------------------------
23120|hp|hbo        ------------------------------------------------------------
998|gene|hla        ------------------------------------------------------------
5292|gene|nph       -------------------------------------------------------MSLRS
1850|gene|hwa       MDNGDDHNHEQGRDSPKDTDTYLENNADNHNQGQINDTTVSTNAEQHLTRTDSSDIAPSE
3606|gene|nph       ------------------------------------------------------------
                                                                                

2404|gene|nrc1      -----------------MSLRNRAQALLALFPAFLARLGLVDRRRGEEAFDLAVPAMVTG
2070|hp|hbo         ---------------MAPSLQRRAHDALMQFPALLARLGLVDREKGSRAFDLAVPVMVTG
1541|gene|hut       -----------------MGLGDRLRRTLRAFPAGLARLGLLERRQATDALELAAPVMVTG
12867|gene|hma      --------------------------------------------------------MVTG
142|gene|hhi        -----------------MSTGGRLRRLLTAFPALLASAGLVDREKATAATDLAAPVMVTG
12783|gene|hma      ------------------------------------------------------------
68|gene|hhi         ----------------MPSTYNPVRGVLLFIGGLLARFDLVERERVRRATDLSWPRIVTG
1672|gene|hut       SRPESSIDSAVQSIKRTGSRANPVRGVILLIGLGLARLGLIDAERARKATDLSWPRVVTG
720|gene|nrc1       ----MQTFFSGASRAPVSMVPNPFSWLLRAVGVAIARLGLISESRARRTAELAWPRILTG
23120|hp|hbo        -----MYRIEIGVLHVVSRVPNPIRRCIVSIGLVLAHFGIIDRDRATRTAELAWPRIVTG
998|gene|hla        ----------------MARLPNPFRALILYIGFALARAGLIDRHRVVRTTDLAWPRIVTG
5292|gene|nph       RLYQYVSSLGSRCRRIAERVPNLFRLGVLAVGLALARAGLIDETRARRTTELAWPRIVTG
1850|gene|hwa       DHTDFTMQSGNSISTNNYWIVSTLAPIGVFLATMLDRAGIINQNRLRATVNLAWPRIITG
3606|gene|nph       -------------------MPGAGDDVVDVLGRVLDRLGIIDAERLRPTIELAWPRIVTG
                                                                                

2404|gene|nrc1      GLRTLLRTADFFMVSIATGST---AVAALEIGFQYYFIPFGLALALTSGTISVVSRFKGA
2070|hp|hbo         GMRTLLRIADFLMVSIALGNA---AVAGLELGFQYYFIPFGLALALTSGTISVVSRFVGA
1541|gene|hut       ALRVLLRMADFMMVGIALGDA---AIAGLEFGFQYFFIGFGLSLAVTSGTISVVSRLKGA
12867|gene|hma      GLRILLRLADFLMVGLALGDA---ALAGLELGFQYYFVGFGLALAVSSGTISVVSRLQGS
142|gene|hhi        GLRILLRLADFLMVGLALGDA---AIAGLELGFQYYFVGFGLSLAVSSGTISVVSRLQGA
12783|gene|hma      ---MSKSTVDVAMVGLALGPT---AIAGVGFAAPFWELVFALGAGVAGGTIGMVSQRYGA
68|gene|hhi         LARMSKSTVDVAMVGLALGPT---AIAGVGFAAPFWELVFALGGGVAGGTIGMVSQRYGA
1672|gene|hut       IARMSKNAADVAMVGAASGIATKPAISGVGLAGPFWGLAFALGGGFAAGTIALVSQRFGA
720|gene|nrc1       IGRMSKSAADVAMVGAALGSA---AITGVGYAGPFWGAAFSIGGGLAAGTIALVSQRFSA
23120|hp|hbo        LARMSKNAVDVALVGSASGVA---AITGVGFAGPYWGLAFALGGGVAAGTLALVSQRYGA
998|gene|hla        IARMSKNAVDVAMVGVAVGTS---AVAGVGFAGPYWGLAFALGGGVAGGTIALVSQRFGA
5292|gene|nph       IARMSKNAVDVAMVGVAVGSS---AIAGVGIAGPFWGLAFAIGGGIAGGTIALVSQRYGA
1850|gene|hwa       FAIMSKRTVDLAIVGIAVGTD---AVAGLTVANAFWMVAKFVFIGLAGGTLSLVSQNYGG
3606|gene|nph       FAIMSKQTADLAMVGIAVGTA---GTAGLAFALGYWSIVVLFGLGLAGGTVSLVSQNYGG
                            .*. :*. * *     . :.:  .  ::     .  ..:.**:.:**.  ..

2404|gene|nrc1      DDHAGANFAIKQSLWLALLVSLPITAGTWVYADSMIGLLNSNPEIIELGAAYLRVVMLTV
2070|hp|hbo         NDYDAADFAVKQSLWLALLISVPISIAGWMYARPLIALLTNDLQTIKLGSAYLRIVMLSV
1541|gene|hut       GRHARADLAVKQSLWLALAISLPLTAIAWLFAEPLVGLLTGDAVVIDLGGTYLRLVMLAL
12867|gene|hma      GQPDRANLAVKQSLWLAIVLSLPLTAVAWVYPTALLDVLSDDPAAIQYGATYLAIVMLSM
142|gene|hhi        DQPERANLAVKQSLWIALLISIPLSALCWRYPDLLVGVLTDDPATIRFGATYLAIVMLSL
12783|gene|hma      DAGEELAVTVTTSSVVVVAATVPFAVVYWVLPGLLVDLVGTGPQAIRYGVRYLRVVALGV
68|gene|hhi         DAERELAVTVTTSAAVVLGLTLPLMAAYWVIPGLLVDLVGTGSEAVGYGVEYLRVVALGV
1672|gene|hut       EEFGQLGQAVRSSFVVVVAVTLPVGAAFWLFPEWLISLLNSDQQVITYGATYLQILGLGV
720|gene|nrc1       DEIADAGQALRSSAALTVAATLPIAVLFYSHPAALIGLLTDRQAEIAFGADYLRVVAFGV
23120|hp|hbo        DQSDGIGVAIRSSTLLVVLSTLPVTVIFWLFPVQLISVLTDNPNVIDLGARYLRLVGLGV
998|gene|hla        EAYAELGDAVRASVLLAIVITIPVSVTFWTFPTRFIDVLSSNEAAIAFGADYLRIVGLGV
5292|gene|nph       DAYDELGQAVRTSAFLVVIASLPLVAVFWTYGPQLVGLLSSDPEVVRLGGDYLRLVGFGI
1850|gene|hwa       DRADRATTVVYISFIIAIGIGVIIVPVFVVAATDLIALVEGNPAVVSLGAAYLAVVAPGL
3606|gene|nph       GRDDRASLVVKQSALLAALFAAPVMAIFSLFGSELISILGATPEEVRHGTAYLLLIAPAV
                            .:  *  :.      .          :: ::      :  *  ** ::   :

2404|gene|nrc1      VFRFWGMTASRALAGAGDTRTPMYVRLITLPTNIALNAVLIFGIWVFPELGVVGAAWGTA
2070|hp|hbo         AFRFWSMIAARALAGVGDTRTPMYVRLLTLPTNIILNAVLIFGLFGAPALGVEGAAWGTV
1541|gene|hut       PFRFFSMVASRALAGGADTETPMYVRLLTLPINVTLNALLIFGLGPAPRLGIAGAALGTV
12867|gene|hma      VPRFWSMVAARALAGSADTRTPMYVRLLTVPTNVVLNGVLIFGFGPIAPMGIAGAAWGTV
142|gene|hhi        APRFWSMVAARALAGSADTKTPMYVRLLTLPTNVALNAVLIFGVGPFPELGIAGAAWGTA
12783|gene|hma      PFAVLNLIGSRALVGADDAWTPMLLRAGGAVGNIVLSAVLIFVAD----LGVVGAALGTV
68|gene|hhi         PFAALNLIASRTLVGADDAWTPMLLRAGGAVVNIALNAVFIFGFG----LGVVGAALGTV
1672|gene|hut       PFAGLNLVGSRVLIGADDAQIPMILRGGGAVLNIVLNGVFIFGMG----MGVAGAAWGTV
720|gene|nrc1       PFAGLNLIGSRALIGADDAYTAMVLRGGGALANIGLNGVFIFGLG----WGVVGAGLGTV
23120|hp|hbo        PFAGLNLVGSRALVGADDAYTAMLLRSGGAVTNIILSATLIFGLD----MSVEGAAVGTV
998|gene|hla        PFAALNLVGSRVLVGCDDAYTAMQVRAGGAIANIVLSAAFIFGLG----WGVEGAALGTV
5292|gene|nph       PLAGLNLVGSRVLVGSDDAYTAMVVRAGGAVANVVINAVLIFGLG----MGVEGAALGTV
1850|gene|hwa       LFEGINMIGSRTYAGVGDTVTPMLFRATGGVLNIILSAVLVFGTG----LGVVGAALGTT
3606|gene|nph       LFELLNLIASRTYTGVGDTFTEMVIRSVGAVLNLVFSALFVFGLG----MGVAGVALGTT
                         .: .:*.  *  *:   * .*      *: :.. ::*        .: *.. **.

2404|gene|nrc1      IANAVAGIVFFAVLLSGR--------WDVTLSFSGKQWDWGVASEIVRVSLPLAGTRLSR
2070|hp|hbo         AANTLAAVIFFVLLASGR--------WDVRLRFGGKQWDWDVVSEIVRVGLPLAGTRLSR
1541|gene|hut       IANVVAAMAFFALLVSGR--------FTVSLRLGGRQVDPGLAAEIVRVATPLAGMRLFQ
12867|gene|hma      AANTLAAVIFFGLLASGR--------YATALPLGGKQFDLGLLTELVRVALPLSGMRLLQ
142|gene|hhi        IANTLAAVIFLGLLLSGR--------YVVTLRPGGTQFSADLMREIVRVALPLSGMRLLQ
12783|gene|hma      VANVLVTVGFAVGLTRGRLPLVG--TLPIQIPVTRPFFDSGLARDLTRTGAPLVGANLAR
68|gene|hhi         IANVLVTAGFAVGLARGGLPIIG--AFPVRVPVSWPFLDRGLGRDLAETGAPLVGANLAR
1672|gene|hut       AANVLVTSLFIVGLIAGWLPGIG--QFPVSVSPRGTYFHWDDITDVVSIGTPVVGRNMTW
720|gene|nrc1       LSNVVVTTAFVVGLSRGRLPAVG--AFPMTVSVRGAYWVRDDCWDIVTIGLPVVGRNSVW
23120|hp|hbo        LSNVVVTGAFALGLTRGELPGVG--EFPIRIDPFGRYVDREIIDDIVSIGLPVFGRSLVW
998|gene|hla        LSNVLAVAAFAVGLLRGRLPGMG--EFPIAIDPFGSYVNPDMLHDLVEIGVPVGARNLVW
5292|gene|nph       LSNAAVTAAFALGLTFGRLPGAG--RFPVTVDPVGGYVDRATARDLIAIGAPVMGRNLVW
1850|gene|hwa       IATAVVAVAFGWGLTGRNDDSWT--ACPISLDQTAS-LEWDLTREVIEVSTPLIARRVAQ
3606|gene|nph       LSTGIAMVVLGWGMFGHTYGGLGMKPSPVPVSLSGPFADLTVARQLLEVAAPEIARRVAQ
                     :.  .   :   :                :             ::   . *  .    .

2404|gene|nrc1      TFGRFPFLFVLGLFSHQVVAAYAIGRRVMLLALMPAWGYSTASSTLVGQQLGAGDPDEAA
2070|hp|hbo         TFGRFPFLFVLGLLGTNVVAAYAIGRRVMLLALMPAWGYSTAASTLVGQAIGGGDDGEAT
1541|gene|hut       TFGRFPFLFILGVLGTPVVAAYAIGRRVIMLALMPAWGYSTAASTLVGQSLGRGAEDEAT
12867|gene|hma      TFGRFPFLFILGVLGTPTLAAYAIGRRVMLLALMPAWGYATAASTLVGQSLGADDPKEAT
142|gene|hhi        TFARFPFLFILGVLGTPTLAAYAIGRRVMLLALMPAWGYATAASTLVGQSLGAGDEREAT
12783|gene|hma      TGAQFPRLFIVGLFGPGVVSAYVVALRVRALLDTPNWGLSLASSSLVGQALGDDDEAEAT
68|gene|hhi         TGAQFPRLFIVGLFGPGVVSAYVVALRVRALLDTPNWGLSLASSSLVGQALGDGNEGEAT
1672|gene|hut       TVARFPMLFIVGMFGTTVLTAYTVARRIWGLMNVPGWGFGLAASSLVGQHLGEDDEETAG
720|gene|nrc1       TLARFPLLAFMSLFGQPVAAAYIIVRRVFGIMNTPGWGFGLAASSLVGQELGQGRESTAA
23120|hp|hbo        TVAEFPMLAIVNLFGKNVAAAFVITRRIWGLMNTPGWGFGLASSSLVGQALGKDDEDTAE
998|gene|hla        TAAEFPMLAILDVFGENTVAAFVIARRIWGIMNAPGWGFGLASSSLVGQELGGEDPAEAE
5292|gene|nph       TVAEIPMFAILDIFGSDVVSAFVIARRVWGLLNTPGWGFGLASSSLVGQELGTGDESTAE
1850|gene|hwa       GMVVFPLLAIASTFGPVTVAAVGVARQIRELLNSFTWGFSIASSTLVGQALGGGNESLAT
3606|gene|nph       GLTIFPLLWIAASFGPVVVTALEVARRVRALIDSVNWGMSLASSSLVGQRLGAGEETAAD
                        :* : .   :.  . :*  :  .:  :     ** . *:*:**** :*      * 

2404|gene|nrc1      AYGWQTLRVALATQLIIGALLFVAAGPIASAF--TPE--RFSLTVTFIRIFGLSVAGFSV
2070|hp|hbo         EYGWQTLRIALVTQLLIAAAIFVAATPIAQVF--GAS--DIPLTARFIRVFGLGVAGFSV
1541|gene|hut       GYGWQTLRIALATQLPVALVLVIAARPIAVAF--GTE--YVDLTVTFIRVFGLAVAGFSV
12867|gene|hma      AYGWQSLGVALAVQLAVALLLVVFARPIVSLF--GTA--YPDLAATFVRVFGLLVAGFSM
142|gene|hhi        AYGWQTLRVALAVQLVAAVLLVVFARPIVALF--GTA--YPDLAAAFVRVFGLLVAGFSI
12783|gene|hma      VWAETVLRLSIGVYIVVAAMLLPFSRGIARLFVSDPT--VLPLVTVFVAVACASVVFRGV
68|gene|hhi         VWAQTVLRLSVGVYIVVAATLLPFSRGIARLFVSDPT--VLPLVTVFVSVACASVVFRGV
1672|gene|hut       VYGREIVLMAVATYGVSAAVVALVARPGVVLL--GAEGEVIPIAVGMVFAGCLAIIPQGV
720|gene|nrc1       AYGREITLYSVVMYVMFAGVVCAFAGQIVGVFVDSASDPSVPIAVTMVYVAAAAVIPQGI
23120|hp|hbo        AYGREIVRFSVATYIVSAVLVAIFAEPIVRQFVKNPGPDVVPTAVGLVYAACLAVIMQGV
998|gene|hla        AYARDIIRFSVATYVVFAALTAVFAGDIVALFAESPESPEVPIAITFVYAACVAVVFQGI
5292|gene|nph       AYGRDIIRFSVAVYIVSAAVVFAFAGPIVEAFVDDPTGPEVPIAVDLVRVACVAIVLQGV
1850|gene|hwa       DYGREITLLSFIIYLGATTIVIALARPIANVFV-GVD--AVALTATFVSIAAFSAIATGI
3606|gene|nph       AYGAGIIRLTMVVYLVVAAIVVALATPIAGLFVSGSE--AVAVTAAFVAVAAVSAIGLGL
                     :.      :.             :   .  :           .  ::          .:

2404|gene|nrc1      ARTLRGALRGAGDTRWPLYGGLIGTYIVRLPLAFLALDPGQIISAGPWVIDATVHSLSVG
2070|hp|hbo         SRTMRGALRGAGDTRWPLYGGLVGTYLVRLPIAFLAPGAGFTIA----------------
1541|gene|hut       SRTMRGSLRGAGDTRFPLYGTTLGIYAVRLPIAALALPAGYAIT----------------
12867|gene|hma      SRTMRGSLRGAGDTRWPLYGTVLASYCYRLPVAALALPTAFVIP----------------
142|gene|hhi        SRTMRGSLRGAGDTRWPLYGTFLGGYCYRLPVAALALPSSFIVT----------------
12783|gene|hma      DGGSVGPLRASGDTRWPFYSQLAGMYLFALPLAYLG------------------------
68|gene|hhi         DGGSTGPLRASGDTRWPFYSQLAGMYLFALPLAYLG------------------------
1672|gene|hut       NSTIAGALDASGDTNWPFIYQTLGVFAVSIPAAYLG------------------------
720|gene|nrc1       GATVAGALDATGDTRWPFYSRAVGMLG-ALPLVYLG------------------------
23120|hp|hbo        SGASAGPLDASGDTSIPFYSQLLGMFGCSIPITYLG------------------------
998|gene|hla        SGGAAGPLDAAGDTKIPFASQFLGMFCVSIPLAYVGAYEATPAIDVPGL-----------
5292|gene|nph       SGGAAGPLDAAGDTRWPFASQALGMFGVSIPLVLVG------------------------
1850|gene|hwa       DGSVTGALRGAGDTRIPFVTTLIGLYVVALPIAWIG------------------------
3606|gene|nph       DGTASGVLVGAGDTRRPFVASLIGRYLFALPAAFLG------------------------
                         * * .:***  *:     .     :* . :.                        

2404|gene|nrc1      PVTTPTIALGVLTIPGFTVAPGLGWGFAAIFLAIVGDMYTRAAVNFVRFRSGAWRA----
2070|hp|hbo         -------------VLGITISPGLDWGLWAVYAAILADMYVRGVINVARYYSGKWIHVAHE
1541|gene|hut       -------------VAGSSLPLGVGLGPPAVFVAIVADFYVRASVNTGRFAGGAWQEVARR
12867|gene|hma      -----------IPVIGVSFSPGLGLGLPAIFAALIGDFYLKAAVNVGRFRSGKWRAVARR
142|gene|hhi        -----------VPLVGVAVSPGLGLGLPAIFAALVGDFYLKAAVNAGRFWSGGWRDVARR
12783|gene|hma      -----------------YVTP---LGKLALYASLVVETAVPAAVTYYRFRSGTWRVVSRS
68|gene|hhi         -----------------YVTP---LGELALYASLVVETAVPAAVTYYRFRSGTWRVVSRS
1672|gene|hut       -----------------AKTS---IGVWGIYVAFLGETLVPAVGNYYRFSTGKWKAISRE
720|gene|nrc1       -----------------ATTP---LGLYGIYLSLFSETCVPAVVNYLRFRSGKWKAISRE
23120|hp|hbo        -----------------AQTG----HIEALYLALLAETTVPAAINYYRFTTGKWKSVSQQ
998|gene|hla        ----------GVTIPEIALPA---IGLWGVYLAFVAETTIPAAINYWRFRSGKWKAISEA
5292|gene|nph       -----------------ALTP---LGIYGLYLAFLAETAVPAALNYYRFRSGAWKAVSRE
1850|gene|hwa       -----------------TVTS---LGATALLGALLAEKVIPMILNGARFRTGTWKRISRS
3606|gene|nph       -----------------LVTP---LGVGGLYLALVLESFVPGGINYGLYRSGRWKVISRR
                                       .        .:  ::. :       .   :  * *      

2404|gene|nrc1      YGTPTA-AAD
2070|hp|hbo         SNVGSA--AD
1541|gene|hut       SGVG---VEE
12867|gene|hma      AGVGRT--DK
142|gene|hhi        AGVGAT--DD
12783|gene|hma      YRPDAA-LDD
68|gene|hhi         YRPDAA-LDD
1672|gene|hut       YRPETA-LDD
720|gene|nrc1       YRPDAA---D
23120|hp|hbo        YRPGSP-ADD
998|gene|hla        YRPDAP-VDD
5292|gene|nph       YRPEAGRADD
1850|gene|hwa       YRPGPD-PSD
3606|gene|nph       YRPGTD-IDK
                             .