HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0003COG0697KOG4510 KOG1443 KOG1581 KOG2234 KOG2765 KOG2766 KOG3912arCOG00271 Permeases of the drug/metabolite transporter (DMT) superfamily hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0003 nrc1 VNG1350 vng1350 no entry
cHOG0003 nrc1 VNG1626 vng1626 no entry
cHOG0003 nrc1 VNG6293d vng6293 no entry
cHOG0003 hmu HMUK2354 Hmuk_2354 protein of unknown function DUF6 transmembrane
cHOG0003 hmu HMUK1533 Hmuk_1533 protein of unknown function DUF6 transmembrane
cHOG0003 hma RRNAC0008 hypothetical protein
cHOG0003 hma RRNAC0516 hypothetical protein
cHOG0003 hma PNG7270b hypothetical protein
cHOG0003 hma PNG7294b hypothetical protein
cHOG0003 hma PNG7332b hypothetical protein
cHOG0003 hwa HQ2738A rhaT DMT superfamily drug/metabolite transporter
cHOG0003 hwa HQ3044A transporter of the drug/metabolite transporter (DMT) superfamily
cHOG0003 hla HLAC2049 Hlac_2049 protein of unknown function DUF6 transmembrane
cHOG0003 hla HLAC1853 Hlac_1853 protein of unknown function DUF6 transmembrane
cHOG0003 hla HLAC1470 Hlac_1470 protein of unknown function DUF6 transmembrane
cHOG0003 hla HLAC3540b Hlac_3540 protein of unknown function DUF6 transmembrane
cHOG0003 hbo HBOR01090 Hbor_01090 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hbo HBOR08430 Hbor_08430 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hbo HBOR08800 Hbor_08800 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hbo HBOR30300b Hbor_30300 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hbo HBOR15250 Hbor_15250 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hut HUTA2022 Huta_2022 protein of unknown function DUF6 transmembrane
cHOG0003 hvo HVO_1790 HVO_1790 putative integral membrane protein (TBD)
cHOG0003 nph NP2642A tp24 drug/metabolite family transporter 24
cHOG0003 nph NP3074A tp23 drug/metabolite family transporter 23
cHOG0003 nph NP3806A tp25 drug/metabolite family transporter 25
cHOG0003 hhi 1126 rhaT2 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hhi 771 rhaT1 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hhi 5285 HAH_5285 hypothetical protein
cHOG0003 hhi 5263 rhaT4 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hhi 5221 rhaT3 DMT(drug/metabolite transporter) superfamily permease
cHOG0003 hhi 4153 HAH_4153 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4153|hp|hhi         -----------------------------------MKEGIE-----------------SQ
30300|gene|hbo      -----MVATPRKQFRVPAGLAIVGLGALWGAGFPAIDIVVE--------QLPPLGAAGIR
7294|hp|hma         MLRSAVTERPSIPARYRDSALFVLLAVLFGGSFVAIKTGLR--------ELPPVLFAGLR
5263|gene|hhi       MLRSTSTDRPSIPARYRDTALFVLLAVLFGGSFVAIKTGLR--------ELPPVLFAGLR
7270|hp|hma         ----------MTHSTRYIGLLFAALALIWGLSFVAIKTGLE--------SVPPVLLAAVR
5285|hp|hhi         ----------MTRSTRHIGLLFAALALIWGLSFVAIKTGLE--------GVPPVLLAAVR
2049|gene|hla       ------------MSRHRNIVLFFTLALLWGASFVAIEVGLD--------YYPPVLYAAYR
3806|gene|nph       ------------MSLRRAIGLFAVASLAFGGTFVAARAGQV--------YIPPLLFVAIR
8430|gene|hbo       ------------MSRYRSLVFFLAASAFFGGTFVAAKAGLE--------FFPPLLFVAYR
10008|hp|hma        ------------MISRRTFALAAVASVLLGGTFVGAKAGLS--------YLPPLLFVALR
771|gene|hhi        ------------MISRRTLALAAVASVLLGGTFVGAKAGLS--------YLPPLLFVALR
3044|gene|hwa       ------------MSARRAFGLFIASAVLFGGTFVGAKAGLP--------YFPPLTFVAIR
3540|gene|hla       ------------MFSQRTGALFLVSAVLFGGTFIAAKAGLA--------YFPPLFFVAVR
1470|gene|hla       -----MNLRTLLSTPESIVAAFVLLATLWGTSFVAIEAGLH--------YFPPLLFAGVR
1350|chp|nrc1       -----MSFRRPTLGETPTTVLFLLLAAIWGSSFVAIKIGIA--------DVPALSFAAIR
15250|gene|hbo      -----MSIRTRSDTSNWNALLFIALSCFWGTSFVAIEAGLE--------YFPPLLFAGIR
1090|gene|hbo       -------------MRHRTTAAFVFLSAIWGTAFVATKVGLA--------SLPPTLFAAMR
6293|chp|nrc1       ------------MSRYRTTGRFLLLCAVWGTAFMATDVGLA--------DLPAVPFAAVR
7332|hp|hma         ------------MSRYRTTGCFLLLAAIWGTAFMATDVGLA--------DLPPVPFAAVR
5221|gene|hhi       ------------MSRYRTTGCFLLLAAIWGTAFMATDVGLA--------DLPPVPFAAAR
3074|gene|nph       ------------MRPLRNLGLFFLLAALWGFSFPAISAGLE--------ALPPLLFAALR
1626|chp|nrc1       ------------------------------------------------------------
2642|gene|nph       -------------MRYRNTALFVLLAAVWGSAFVAIKAGVGSPDAPGYFFDAPVLFAAVR
2022|hp|hut         -----MPQDRTPTVRYRNATAFLALGAIWGSAFVAIKAGLS--------AFPPVLFAALR
10516|hp|hma        -------------MRFRNAILFVALAIAWGSAFTAIKAGLE--------YFPPILFAAFR
1126|gene|hhi       -------------MRFRNAILFVALAVAWGSAFTAIKAGLE--------YFPPVLFAAFR
1853|gene|hla       ------------MSRTRNLSLFLILAAVWGSAFMAIKAGLT--------YFPPVLFAALR
2738|gene|hwa       --------MRTPVRRYRTIGLFIILAGAWGSAFMAIKAGLP--------YIPPVLFAALR
8800|gene|hbo       ------------MTRYRNVGLFLFLAAVWGAAFMAIKAGLGTPSDPGGFFETPVLFAAIR
                                                                                

4153|hp|hhi         YDD--------------PDSYRGDYPPDWAYRIVFRKQL--DNNTCTNCGTR-----FPA
30300|gene|hbo      YAVSGCIVLAYAAAT--TDRLLPKTWRELLGIAVIGGFMFGGYQAGLYMGTTY--V-SGA
7294|hp|hma         FDLAAVTLLGYIVFTRPRSTWLPRTRGDFVGIGMAALFLIALNNGLLFLGQGA--T-TPA
5263|gene|hhi       FDLAAVTLLGYIVLTRPRSTWLPRTRADFVGIGMAALFLIALNNGLLFLGQGA--T-TPA
7270|hp|hma         HDIAAVVLLGYALWR--GRSLRPQTRDDWSLILIGGTVLIGAHFALLFLGQQY--V-PSS
5285|hp|hhi         HDIAAVVLLGYALWR--GRSLRPQTRDDWSLILIGGTVLIGAHFALLFLGQQY--V-PSS
2049|gene|hla       FDLAALILVSYVLVT--EADSLPRTRGDLAAIGFSGGLSVAANNSLLFVGQQY--T-TSG
3806|gene|nph       FDLAAILLLGYAAYA-TEGSIRPRTRGDIGGVLAAGVLTIGLANGLLFVGQGY--V-TSA
8430|gene|hbo       FDIGAALLLSVVLYRFPRERWLPRTRADIAGILAAGVFAIGATNALIFVGQQY--V-TSG
10008|hp|hma        FDIAAVVLLGYVVVTRSRDELLPRTRGDVLGILSTGLFALGLANALIFVGQQS--A-TSA
771|gene|hhi        FDIAAVVLLGYIVVTRSRDELLPRTRGDVLAILSTGLFALGLANALLFVGQQS--A-TSA
3044|gene|hwa       FDIGALVLAGYAAHKLSFEQLRPRTRGDIIAILATGVFVIGLTNALIFIGQQY--I-TSG
3540|gene|hla       FDIGAVVLAAFAATSLSRSELRPRTVGDIIGILATGVLVIGLTNALLFVGQQD--V-TSG
1470|gene|hla       YAIAGAIVLGFAAVM--SGRTVPRGRDEWLGVAVAGAFVIAAYHGLLYVGELH--I-TGA
1350|chp|nrc1       YSIAGLIVLAYAAHT--TDRWRPRGRREWVLAATVGLFVIGIYHGALYLGEHD--V-SAP
15250|gene|hbo      YGIAGLAILSYAVAT--TDRWHPSGRDEWLSAAVAGVFIIAAYHALLYIGEMY--V-SAS
1090|gene|hbo       FDIAAAVLFGFAFIR--SDRLRPTSRTEWYPIITGGMLNIGIHHAFLFSGQAY--IDNAA
6293|chp|nrc1       FDIAAALLFAAVFVS--DADVYPRTMDDFVYVLVGGTLTIGAHHAFLFTGQQY--V-TGG
7332|hp|hma         FDIASVLLFAALAVT--GALERPQTRDDYVYVLAGGSLMIGVHHVFLFTGQQY--V-TGA
5221|gene|hhi       FDIASVLLFAALAVT--GSLERPQTRDDYVYVVVGGALMIGVHHVFLFTGQQY--V-TGA
3074|gene|nph       YDVGGVVLLAFLAAR--GADWRPRTGEDALAILIAGAFLIAG-NSLLFVGQQT--V-PSG
1626|chp|nrc1       -------MVAYAALV--ADDWLPRSRTDWTTVGIAAVLMIAAYHAFLFVGEQT--T-SSA
2642|gene|nph       YDIAAVLMFAYVAWA--TDRWRPRGRTEWLAVAVGSAFIIAGYHALLFLGQRG--T-TSA
2022|hp|hut         YDVAGVIVLGYAAVV--TDPL-PESRRDLAAIIVGSTLLIAGYHALLFVGELE--T-TSA
10516|hp|hma        YDLAGLLMLGYAVYA--TDQWVPKSRTDWIVVGIGGSLLIAAYHIFLFVGEQG--T-TSA
1126|gene|hhi       YDLAGLLMLGYAVYA--TDQWLPKSRTDWIVVGIGGSLLIAAYHIFLFVGEQG--T-TSA
1853|gene|hla       YDVAGVVMLAYAAYV--VDDPIPRGRDEWTTVAVGATLIIAAYHAFLFIGESDPAV-TSA
2738|gene|hwa       YDIAGILMLGYALAQ--TDQPVPQTQSGWASVGAGATLIFAGYHALLFIGETDPAV-TSA
8800|gene|hbo       YDVAGVLMLGYAVYA--TDHPVPRGRDEWATVVVGSVLIMAGYHALLFIGETDPAV-TSA
                                                                     *          

4153|hp|hhi         EDLEVVRRIPAENGGTNKTTNLLTVCSFCEEDITQTGRLNLPES-AKQEPASSPETDSH-
30300|gene|hbo      VASVVTTMSPV-------VAAVVAVPILGESR-GILDIIGFFVGIAGVFVLSQPSVGTAS
7294|hp|hma         AASVMYGLNPI-------LAPVFAWWLL-GDRLSWLGALGIGVALSGVILIVQPSPSTF-
5263|gene|hhi       AASVMYGLNPI-------LAPVFAWWLL-GDRLSWLGALGIGIALSGVILIVQPSPSTF-
7270|hp|hma         FGAILLSLTPV-------VTPAFASTLIPSYRARPHELIGTVCGFIGVVIIANPTPGAV-
5285|hp|hhi         FGAILLSLTPV-------VTPAFASTLIPSYRARPHELIGTVCGFIGVVIIANPTPGAV-
2049|gene|hla       IASITYSLVPI-------ATAAVAAAWIGGSDLDARGGLGVVLAFIGVGLVAQPDPANL-
3806|gene|nph       VGAILFSLVPI-------IAPLFAALLLSDERVSALGAVGMGVAAIGVGMVVGVSPSNL-
8430|gene|hbo       VSSIIYSLNPI-------MTPILAAFLLSDERLSRSGAGGMLLGLVGVALVVNLNPADL-
10008|hp|hma        VAAIIFSLNPI-------LTPVFAAILLSDERLSARGGLGMVIGLLGVGLVVSPDPAML-
771|gene|hhi        VAAIVFSLNPI-------LTPVFAAILLSDERLSARGGLGMVIGLLGVGLVVSPDPAML-
3044|gene|hwa       VAAIIMSLNPI-------LTPVFAAFALSDEPITRRGVIGIVAGLIGVGLVANPDPSAF-
3540|gene|hla       VAAVVFSLNPI-------LTPVFAAVLLSEDRLSVRGSAGMVLGLLGVGLVANPDSTAL-
1470|gene|hla       VAAVVVSLSPV-------LTATFAALLLPNERLGPFEIGGFALGILGVIVIADPMEAGL-
1350|chp|nrc1       IAAIVISLAPI-------LTAGFASKLHENVTIDGTQAAGLLAGLAGVVIVANPGSAG--
15250|gene|hbo      VAAVVVSLAPV-------LTAVFAAGIL-GQPLDKIAGVGFLLGIVGVVIVANPDPANL-
1090|gene|hbo       VPAVLLGLIPV-------ITPVLTRLTTSSERLSAVGVVGLVLGFTGVVVIADPKPEAL-
6293|chp|nrc1       VAAVLLGLVPV-------VTPALTRLVATDEQLTAATAVGVMLGFAGVVIIANPDPTNI-
7332|hp|hma         VAAVLLGLVPV-------VTPALTKLASSDDTFTANTGVGVVLGFAGVVVIADPDPANL-
5221|gene|hhi       VAAVLLGLVPV-------VTPALTKLASSDDTFTANTGVGVVLGFVGVIVIADPDPANL-
3074|gene|nph       VAAIIYALIPV-------LTTALAAVLLPAEPLSARRIVGVALGLVGVAVIARPDPEGL-
1626|chp|nrc1       VAAIVVSLSPV-------LTAGFARAVLPGERLSIGGVVGLGLGLAGVVVLSNPDPSNL-
2642|gene|nph       AAAVIVSLSPV-------LTTAFARALLADERLSVLGLAGMGVGFLGVVVLSQPTPADI-
2022|hp|hut         TAAVIVSLSPV-------LTAGFARLALPGDRLSVAGVAGLALGFAGVVVIAQPDPARL-
10516|hp|hma        AAAIVVSLSPI-------LTTGFARAFLPDERLTTLGIVGLLVGFLGVGVLSNPDPGNL-
1126|gene|hhi       AAAIVVSLSPI-------LTTGFARAFLPDERLTALGIVGLLIGFVGVGVLSNPDPGNL-
1853|gene|hla       VAAVIVSLSPV-------LTTVFARAFLPSERLTLVGVVGLLVGLAGAVVLAAPDPSNL-
2738|gene|hwa       AAAVIVSLSPM-------LTTGFARVFLPTERLTLVGFFGVVLGLIGVIVLSSPDLQNI-
8800|gene|hbo       AAAVIVSLSPV-------LTAGFARAFLPVERLTTFGLAGLLLGLVGVAILSDPDPNNL-
                             *         :  .:               .   .                

4153|hp|hhi         RVLALQSEVPITEEVEGETEGNGQSRGVSRLEASHVETQSRSPLAVTTTTGGGDEQSVQD
30300|gene|hbo      VSSTAIGVGLVFLGTTLFAVGSVTIQLFD--EELPAESLQGWAMVVGAGLLFFGAAAR-G
7294|hp|hma         TDASAIGQLLVLGAAAAVALGSVLLQRVG--PQMDSTPLTAWAMAVGAVLLHVASLLV-G
5263|gene|hhi       TDASAIGQLLVLGAAAAVALGSVFLQRVG--PQMDSTPLTAWAMAVGAVLLHIASLLA-G
7270|hp|hma         -GGRLLGVALLISSAVAFAVGAVLTERYT--SSLPLVSLQAWMTLLGAGILHAVSAGLPS
5285|hp|hhi         -GGRLLGVALLISSAVAFAVGAVLTERYT--SSLPLVSLQAWMTLLGAGILHAVSAGLPS
2049|gene|hla       AGGVTIGVGLISIGVIAVAVGSVGLRTVE--TTFSNVALTGWAMLFGALLIHGFSLGL-G
3806|gene|nph       LAESGVGAALVLGGAASAALGTVLTRRCE--ATISSTAQVAWGLPISAVLLHGMSLAV-G
8430|gene|hbo       LGGAVVGKALVLAAAVSGALGSVLIRRAD--STLDSTVRTAWALPVAAVLCHVSSFAA-G
10008|hp|hma        LSGG-IGKLILFAGAASAALGSVLIRWSG--GGLSSTVRTAWALPVAAALCHALSIGM-G
771|gene|hhi        LSGG-IGKLVLFAGATSAALGSVLIRWSG--GGLSSTVRTAWALPVAAALCHALSIGM-G
3044|gene|hwa       --VGTIGLPIIFGAAVVSALGAVVIRWST--PTMSSAARTVWGVPIAAVVTHLLAVMT-G
3540|gene|hla       LGGG-IGIPLLFGAAVTSALGAVVIRRAE--STMSSTARTVWGVPLAAVLSHGLSLSA-G
1470|gene|hla       GSSALLGVALAFAGAAAFSLGAVLLRPLR--TDLPIAALQGWAMVSGAGMLLVGAALL-G
1350|chp|nrc1       -SVDLGGLLLVFLAAASFALGGVLTGKLPGGGGLPVETMEAWAMLIGSLALWVGAAVR-G
15250|gene|hbo      LSTNLLGIVLVLLSTASFAIGGVLTEPLR--TSLPAESMQAWAMLIGAGVLFVGAVAR-G
1090|gene|hbo       LSSDLMGVGLVLASAVAFALGAVLTHGSK--SELPFFSIQAWTMLIGAVFLHATSVALPW
6293|chp|nrc1       -ADSVLGVSLVLASAFAFAVAAVVTHSRS--PSLPFLSTQAWLMATGAVVLHVAVLVLPG
7332|hp|hma         -LSSTIGIALVFAAALAFAIPAVVTHDTS--PSMSFLATQAWLMAIGAAVLHLTVLVLPG
5221|gene|hhi       -LSSTIGIALVFASALAFAIPAVVTHDTS--PSMSFLATQAWLMAIGAVVLHVTVLALPG
3074|gene|nph       LSAQLVGVAFVVAAALSVALGSVLLRRRT--PTVGVAPMTAWAMVVGGLLLHAGSFVA-G
1626|chp|nrc1       VSSTSQGVGLVFAATASFALGSVLTQRID--DALDSEALEAWAMVFGAVVMHVASIAA-G
2642|gene|nph       AASRFEA--LVFAAALCFALGSVLTRRLD--TDLPIETMEAWSMAGGALLMHALSLAL-G
2022|hp|hut         LSSDVIGPLLVFGAACAFALGSVLTRWLD--AELSIEAMEGWSMVGGAVLMHVLSLAL-G
10516|hp|hma        LNPRTVSLFLVFLAAASFALGSVLTRRFD--DDLEIETMEAWSMLLGAVLMHGISFGV-S
1126|gene|hhi       LDPRTVSLFLVFLATTSFALGSVLTRRFD--DDLEIETMEAWSMLLGAVLMHGVSLGA-S
1853|gene|hla       TGGGTVAKLLVLLAAASFALGSVLTRASD--DDLPIETMEAWSMLLGALLMHLLSLAL-G
2738|gene|hwa       VGGGAIAKLLIFAAATAFALGSVLTRRLD--ANLPIETMEAWSMLGGAALMHGVSLLL-G
8800|gene|hbo       LTGGTVAKLLIFAAAICFALGSVLTRRID--ADFPIETMEAWTMLGGAVLMHIVSVGI-G
                          .       .   :                                         

4153|hp|hhi         DTDGRAG-WRRLFVASIGGTAMF---LGYLCAFGISYFLSPIAGNVAFYGLPLAGLVAGV
30300|gene|hbo      EAVPALRSLSPLALGSLLYITLIAGAGGYLLYFRLVRRVGATETTLVAYLEPLSATFVS-
7294|hp|hma         EPPTAVIGIGPETIASIVAVGIPSTAVAYAIYFGLINRIGPVRANLVAYVVPIFAALMG-
5263|gene|hhi       EPPTAVIGIGPETIASIVAVGIPSTAVAYAIYFGLIKRIGPVRANLVAYVVPIFAALMG-
7270|hp|hma         EQLGTVT-VGLEQLAAIAYLGIVASAIGFLLYFRLISTVGAAETSLVSYVVPAVTAISG-
5285|hp|hhi         ERLGTVT-VGLEQLAAIAYLGIVASAIGFLLYFRLISTVGAAETSLVSYVVPAVTAISG-
2049|gene|hla       EPQRLPS-TALPALGALLFLGVLASAVAYVIYFTLLDRLGPFEINLVSYVVPVVATVTG-
3806|gene|nph       ESAAAIE-WTLTAIVSLAYVTVVAGAVGYIAYFALIEEVGALRSSLIFYASPLVAALGG-
8430|gene|hbo       EQASAVT-WTPAALAALGYVGVFSGALAFIAYFGLLDDVGAIRGNLVFYAVPIVATLGG-
10008|hp|hma        ESAATAV-WSPTAIAALLYVGIFAGAIAYIAYFGLLDVTGAIQANLIFYVVPVVSTLGG-
771|gene|hhi        ESAATAV-WSPTAIAALLYVGIFSGAIAYIAYFGLLDVTGAIQANLIFYVVPVVSTLGG-
3044|gene|hwa       ESMAAIS-VTPTAVIALLYVGIGSGAIAYLSYFALIDTVGATRANLLFYLTPVVSALGG-
3540|gene|hla       ESVTGLS-VPPVALAALLYVGVFSGAIAYLAYFALIDETDATQANLLFYFVPIVSAVGG-
1470|gene|hla       ESPAAIV-WNATSIASLSYLTLLSGVVAFLIYFALLDEVGPSQLHLVGYAEPVVAAVGS-
1350|chp|nrc1       ENVTAVH-WTPTALASLAYLTLVCGAGGFLLYFVLLERAGATEINLVSYLEPIGASVVA-
15250|gene|hbo      ESPATIE-WTSTAIISLMYLTFVSGVVGFLIYFALHERVGATEINLVSYLEPVVASLAG-
1090|gene|hbo       ESFAGAR-WTLDAVISLVYLGVVAGAGGFGLYFWLLDHIGPIEASLLEYVIPVFAAIGG-
6293|chp|nrc1       QSFAAAT-WTPSALGALTYLSVVAGVGGFLLYFRLLDDLGPIEMSFIEYVIPVFAALAG-
7332|hp|hma         QSFADAS-WTPSALAALLYLAVVAGIGGFLLYFRLLDQLGPIEMSFIEYVIPLFAALAG-
5221|gene|hhi       QSFADAS-WTLSAFAALLYLAVVAGIGGFLLYFRLLDQLGPIEMSFIEYVIPLFAALAG-
3074|gene|nph       ERLAHAT-PSAVAVVSVVYLAVFASAVGYVVYFTLLERFGPLEINLVSYVVPVVATLGG-
1626|chp|nrc1       E-PQTIP-WTAEAVFAVAYLSVGASAVGFLIYFRLLDSLGPIEINLVGYVAPVFAAAVG-
2642|gene|nph       ETVSGAP--PTDALVALGYLAVVASAAGFLVYFDLLGRLGAIEINLVSYVVPVFAALVG-
2022|hp|hut         ESPAAVE-WTPTALLSLGYLSLVASALGFLLYFALLDRLGPVEINLVSYVAPVFAALTG-
10516|hp|hma        ESVADVQ-WTTEAVLALLYLVVVASALGFLIYFDLLERLGPIEINLVSYAAPVVAAATG-
1126|gene|hhi       ESIADVQ-WTAEAVLALLYLVIVASALGFLIYFDLLERLGPIEINLVSYAAPVVAAATG-
1853|gene|hla       ESVADVT-WSTEAMLALGYLSIVASGLGFLIYFDLLDRLGPIEINLVSYVAPVFAAVSG-
2738|gene|hwa       ESFTAIE-WTTEAILALAYLAVVASALGFLIYFRLLEQLGAIEINLVSYVAPIFAALAG-
8800|gene|hbo       ESVSDVT-WTGETLLAVGYLSVVASAIGFLVYFVLLERLGALEINLVSYVAPVFAALTG-
                    :            . ::    .     .:   * :    ..    .  *  *      . 

4153|hp|hhi         RWRLSTAIASVYVVLMYAAVWDSISTELFMTPFAWVPVVAPLTGIAYG------------
30300|gene|hbo      -VVFFDQTLDETTVIGFLAVAAG---------FTLISR--ETMRHAVA------------
7294|hp|hma         -WVLLGSSVSLWTLVGFLVVVAG---------FALIER--VTIRMELR------------
5263|gene|hhi       -WVLLGSSVSLWTFVGFLVVVAG---------FALIER--VTIRMELR------------
7270|hp|hma         -WLLLGETLGPVTVAGFAVIVVG---------FAWVKA--DVLRSLRR------------
5285|hp|hhi         -WLLLGETLGPVTVTGFAVIVVG---------FAWVKA--DVLRSLRR------------
2049|gene|hla       -AVLLAEPVTALTIAGFAVIVVG---------FGLLKR--HAIADEVP------------
3806|gene|nph       -WWFLGEAITTTTVAGFVTVVAG---------FLVIGH--EQFRAAFR------------
8430|gene|hbo       -WLLLGETISALTVVGFGVICLG---------FVLLGR--ETITAELS------------
10008|hp|hma        -WALLGEAITPTAVAGFLTIFTG---------FVVLGSESVDIRALLP------------
771|gene|hhi        -WAVLGEAITPTAVAGFLTIFTG---------FAVLGSESVDIHALLP------------
3044|gene|hwa       -WIILNESISTLTIIGFVVIFGG---------FLILGG--DSITAVITHRYPQVRTQWTL
3540|gene|hla       -WVLLGETLSLVSLVGFGVIFVG---------FLLVSGLPTGVSGVLR------------
1470|gene|hla       -WALLGSLIEAEAIIGFVAILAG---------FLVLER--HEIAAYVG------------
1350|chp|nrc1       -WALFGDVVSPRALAGFAVIFAG---------FALVKH--RYIGAAVR------------
15250|gene|hbo      -WVLLGHVVSSTTLVGFVTVFIG---------FALVKR--HAIRA---------------
1090|gene|hbo       -WIIRGNAIDTNTVIGFAVIFVG---------FLLVKR--ADVRRELV------------
6293|chp|nrc1       -WLVLGQEITPATVVGFAFILSG---------FLASKW--RALR--LR------------
7332|hp|hma         -WLVLGQQVTLATVGGFGCILLG---------FIAAKW--TALRAELR------------
5221|gene|hhi       -WLVLDQQVTLATVGGFACILMG---------FIAAKW--ATLRAELR------------
3074|gene|nph       -IALLGETLTAGMVAGFVLIASG---------FVVIKA--RTIADELG------------
1626|chp|nrc1       -LLWRGEAITTPTIGGFCIVFTG---------FCVLKR--RAIAAELR------------
2642|gene|nph       -VLLLGERVDTPTAAGFLLVFAG---------FVIIKR--RAIRAEIA------------
2022|hp|hut         -FLLLGERIDVATASGFVVILVG---------FVLLKR--DAIRETYV------------
10516|hp|hma        -LLFLSETPTVYTGVGFTCILVG---------FGLLKR--DALRNEVA------------
1126|gene|hhi       -LLFLGETPTVYTGVGFACILVG---------FALLKR--DALRNEVA------------
1853|gene|hla       -WLFLNEAITSNTVAGFLIICVG---------FALVKR--AAFRDALR------------
2738|gene|hwa       -WIFLSEIPTIATVIGFIIIFIG---------FTLLKR--DAIRDELP------------
8800|gene|hbo       -WLFRGEIPTVYTVVGFIVIFVG---------FLLLKR--ESLRRELP------------
                                    :  :  .         *                           

4153|hp|hhi         ------------------VVAERTEFSLRNLPSDPRLVVQRFR------
30300|gene|hbo      ------------------RLRESDTSEVRS-------------SRNHGD
7294|hp|hma         ------------------RLYRRFEDTSPK------------QTPPCDD
5263|gene|hhi       ------------------RLYHRFEETSSS-----------QQTPPCDD
7270|hp|hma         ------------------RRTDSPSYRPYG--PQDDCVVVSGNAYTTRE
5285|hp|hhi         ------------------RHTGSPPHRTQA--PRDDCVVVSGNAYSTQD
2049|gene|hla       ------------------RLLSRIGGLF---------------------
3806|gene|nph       ------------------RLADGRGQATGG--------------YEPSD
8430|gene|hbo       ------------------RIRRGIAQRAGSGSDSVTGVVGDTPRWSEQD
10008|hp|hma        ------------------ATTDEGDTVSES------LGIADEQRGFESD
771|gene|hhi        ------------------GTADEGDTAPES------LGIADEPRGFESD
3044|gene|hwa       LRERVLSTVLSLKSWYSLRAIQSRDKQTRTKTQTQSQTQSHSHSPSQSD
3540|gene|hla       ------------------RAVDGQFVGSSS-------------------
1470|gene|hla       --------------------VDEPAWAR---------------------
1350|chp|nrc1       ------------------NTTDDAEL-----------------------
15250|gene|hbo      ------------------RILGDVPTTATG-------------HSYDAD
1090|gene|hbo       ------------------RLRERSRTAASD-----------------AD
6293|chp|nrc1       ------------------SVVVTTISSFTG---------------PRDD
7332|hp|hma         ------------------RVVEPKTSPPAD-------------------
5221|gene|hhi       ------------------RVVEPKTSPPAD-------------------
3074|gene|nph       ------------------R------------------------------
1626|chp|nrc1       ------------------ALSE---------------------------
2642|gene|nph       ------------------DSYWP--------------------------
2022|hp|hut         ------------------GWLAEAQP-----------------------
10516|hp|hma        ------------------RFSGTPNRGE---------------------
1126|gene|hhi       ------------------RFSGTPNRGD---------------------
1853|gene|hla       ------------------------EYGVVG-------------------
2738|gene|hwa       ------------------QIRQALN------------------------
8800|gene|hbo       ------------------RLRRELKTF------------------GTRE