HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0296COG0003KOG2825arCOG02849Oxyanion-translocating ATPasearsenical pump-driving ATPase

HOG Organism Gene ID Name Annotation
cHOG0296 nrc1 VNG0365 arsA1 arsenical pump-driving ATPase
cHOG0296 hmu HMUK2970 Hmuk_2970 arsenite-activated ATPase ArsA( EC:3.6.3.16 )
cHOG0296 hma RRNAC0678 arsA2 arsenical pump-driving ATPase
cHOG0296 hwa HQ1236A arsA transport ATPase ( substrate arsenite)
cHOG0296 hla HLAC0661 Hlac_661 arsenite-activated ATPase ArsA
cHOG0296 hbo HBOR24910 Hbor_24910 arsenite-activated ATPase ArsA( EC:3.6.3.16 )
cHOG0296 hbo HBOR38790b Hbor_38790 arsenite-activated ATPase (arsA)( EC:3.6.3.16 )
cHOG0296 hut HUTA2461 Huta_2461 arsenite-activated ATPase ArsA
cHOG0296 hvo HVO_0724 HVO_0724 arsA arsenical pump-driving ATPase
cHOG0296 nph NP1164A tpa07 transport ATPase 7 ( substrate arsenite)
cHOG0296 hhi 1331 arsA2 arsenical pump-driving ATPase
cHOG0296 hhi 839 arsA1 arsenite transport ATPase
MUSCLE (3.6) multiple sequence alignment


1164|gene|nph       -------MSDLSVEPIDSVD-----------------------------EADLPAGVDAP
365|chp|nrc1        -------MDEIEVEAVDSLD--------------------------------PGITVDTA
2461|gene|hut       -------MNDIDVEPVEEID-----------------------------ESVVPTGIEGS
10678|gene|hma      -------MSELDVEAVDDIN--------------------------------APAGIDAA
1331|gene|hhi       -------MSELDVEAVDDID--------------------------------APAGIDAA
661|gene|hla        -------MDDIDVEPVDRVEEPEINE-TADADPASDADLPTE----TDAATDLPAGVDAP
1236|gene|hwa       MGLVALHMSSIDVDAVDAVEDDS----TADDTTESNHDHAVDVEI-VDDATTLPESVDAP
24910|gene|hbo      -------MANIDVEPVDRVEDDEEDAHDGHGAPDDSTELSVDVEARTTDETDLPDRVDAP
38790|gene|hbo      -------MTETEHPHGDETD----------------------------------------
839|gene|hhi        -------MTR--------------------------------------------------
                           *                                                    

1164|gene|nph       EYVLYGGKGGVGKTTCAAATALASA-RDGTPTLVVSTDPAHSLSDTLGVDVPDEPTRIAE
365|chp|nrc1        EYVLYGGKGGVGKTTMAAATAVASA-SDGTNTLVVSTDPAHSLSDTLEAEIPSRPHRIRE
2461|gene|hut       EYVLYGGKGGVGKTTMAAATALASA-RDGTATLVVSTDPAHSLSDTLETDIPAEPAQIRE
10678|gene|hma      EYVLYGGKGGVGKTTCAAATALASA-RDDTATLVVSTDPAHSLSDTLDADIPATPTRIRE
1331|gene|hhi       EYVLYGGKGGVGKTTCAAATALASA-RDDTATLVVSTDPAHSLSDTLEADIPATPTRIRE
661|gene|hla        DYVLYGGKGGVGKTTMAAATGLASA-AGGVNTLVVSTDPAHSLSDTYETEIPAKPARIRE
1236|gene|hwa       EYVLYGGKGGVGKTTMAAATAVASA-TAGTDTLVVSTDPAHSLSDTFDTDIPPEPARIRD
24910|gene|hbo      EYVLYGGKGGVGKTTMAAATALSSA-ATGTATLVVSTDPAHSLSDTLGVEVPADPSRVRE
38790|gene|hbo      -IVLYGGKGGVGKTTCAAAHALALSKRREGDTLVVSTDPAHSLGDAFEQELSGEPTEVVD
839|gene|hhi        -FLLYGGKGGVGKTTVAAATGHRLA-TAGHETLVVSTDPAHSLADAVETDVGGDPTEIKS
                      :************ *** .   :      ************.*:   ::   *  : .

1164|gene|nph       ETPLFAVEIDPETA----AGPFAPGEDGPD-------------ADPLEGAAGPDGAAGPE
365|chp|nrc1        NVPLWAVEIDPDDALDR-TGMFGQDGALSG---------------TLETMLGGD------
2461|gene|hut       DMPLYAAEIDPEAALG--DDPLGLEGGGLG---------------GLGDLLGDD------
10678|gene|hma      DIPLYAAEIDPEAAVG--EGPLGVEEDALG---------------GVGELLGGDGMFGGG
1331|gene|hhi       DIPLYAAEIDPEAAVG--EGPLGVEEDALG---------------GVGELLGGDGMFGGG
661|gene|hla        DMPLYAAEIDPDDAME--EGMFGADGDPLG---------------GMGEM--GDAMGGMM
1236|gene|hwa       DIPLYAAEIDPDSVA---AGPFAEGEGEGD---------------DISDNIGGNEDASAG
24910|gene|hbo      DIPLYAAEIDPDEVI---EGPFASDEGTGGFDAVDLDADDNPFEDDTDDGFGDETATDNP
38790|gene|hbo      S--LFAIEVDAETGQEAYRHVVEALADEFR---------------DAGLRLDDD------
839|gene|hhi        G--LWGVEIDPQTGIDRYRSLFEALASEFA---------------DAGIRMDED------
                       *:. *:*.:         .                               :      

1164|gene|nph       DGG---------LGMGMGGLEDLLGG-------DGHPLAG----GAMPGADEAAAVQLLL
365|chp|nrc1        -------------------AGAPGGG-------DG--SA-----AMMPGADEAAAMQLLL
2461|gene|hut       -------------------VTDPFTN-------------------AMPGTDEAAAIRLLI
10678|gene|hma      AG----------GAAGAGQAEDPIGG-------EEGLLG-----GSMPGADEAAALRLLL
1331|gene|hhi       AG----------GAAGAGQGEDPLGG-------EEGLLG-----GSMPGADEAAALRLLL
661|gene|hla        GG----------ASDPDGPADDEADG------GLGSLLG-----GTMPGADEAAAMRQLL
1236|gene|hwa       FGEPESGFETGIGGDPGAETGMPFGNLDEMDDVLGGLMGPASGAGAMPGADEAAAMQQLL
24910|gene|hbo      FG----------GQNGQNPFGMDMGG-------MEDVLGDMMGPGSMPGADEAAAMQQLV
38790|gene|hbo      ------------------DLERLFKA------------------GLVPGGDEVAALEYIA
839|gene|hhi        ------------------EIADLFTT------------------GVMPGSDELAAIEGMA
                                                                  :** ** **:  : 

1164|gene|nph       EYLDDPRFDRVVVDTAPTGHTLRLLELPDVMDSMVGRLLSFREKLSGMMGSVGGL-FGGS
365|chp|nrc1        EYLDDDRFDRVVVDTAPTGHTLRLLELPEVMDSMVGQLMQVRERLGGMMDGLTGM-FGGD
2461|gene|hut       RYLDDERFDRVVVDTAPTGHTLRLLELPEVMDTMVGKLLSFRERLSGMMGTITGM-FGDA
10678|gene|hma      DYVDDDRFDRVVIDTAPTGHTLRLLELPETMDSMVGKILQLRERFSGMMDNLTGM-FGDD
1331|gene|hhi       DYVDDDRFDRVVIDTAPTGHTLRLLELPETMDSMVGKILQLRERFSGMMDNLTGM-FGDD
661|gene|hla        EYLDDPRFDRVIVDTAPTGHTLRLLQLPEIMDSMIGRVMKLRNRFSGMMDGIKGM-FGGG
1236|gene|hwa       EYLDDPRFDRVIVDTAPTGHTLRLLELPELMDTMLGRIASLRQQFSGMMGSVKGM-FGFG
24910|gene|hbo      AYLDDPRFDRVVVDTAPTGHTLRLLELPELMDSMLGRIARMRQKFSGMMDNIKGM-FGAG
38790|gene|hbo      RYADAG-YSHVVFDTAPTGHTLRLLDLPEVLGETLGVAGEVQRRVRRTAQAAKSVFFGPA
839|gene|hhi        TYIESDRWDRVVFDTAPTGHTLRLLDLPSVMDRGVATAMDLRDQVRRKVNTARTMMFGPM
                     * :   :..*:.************:**. :.  :.    .. ..         : **  

1164|gene|nph       DDPEAEMEAGMDDLQELSTKIERLRTALRDPDRTDFRVVMVPEEMSVVESERLVDRLEEF
365|chp|nrc1        DD--ASAEQTMGDLDAVKERVEQLRAVLTDPQRTDFRVVLVPEELSVAESNRLITRLDEY
2461|gene|hut       DE--DDIEEGLDDLRVLRERIERLRSILQDPAKTDFRVVMVPEELSVMESERLLERLAAF
10678|gene|hma      QD--VDAEAGIEDLQELSDRIEHLRGILQDPQRTDFRIVMVPEELSVVESERLLAQLGEF
1331|gene|hhi       QD--VDAEAGIEDLQELSDRIEHLRGILQDPQKTDFRIVMVPEELSVVESERLLAQLGEF
661|gene|hla        DD----DPDPSADLDELRERIERLRSVLQDPEKTDFRVVTIPEEMSVTESERLVARLDEF
1236|gene|hwa       DE--TNAQSEV-DLDELRERIERLRSVLRDPTRTDFRVVMIPEEMSVVESERLITRLEGY
24910|gene|hbo      NP----NQAGMGDLDELRERIERLRAVLRDPQQTDFRVVMIPEEMSVVESKRLIDRLDGY
38790|gene|hbo      AY--WGSNSGSDEVVSLQERVGSVQQVLRDPSRTHFCVVLTPERMAIAEAERLVERLDEA
839|gene|hhi        AN---RRDDGPDDFTAMRERMERVGMVLRDPEQTAFRVVTIPETMAVRETERLVGKLREF
                                :.  :  .:  :   * ** .* * :*  ** ::: *::**: .*   

1164|gene|nph       GIPVGTLVVNRVSEELADV-----ASFDEEWFVAPDTENCAFCRRRWEVQRTALERAQGL
365|chp|nrc1        GVPVNTVVVNRVMEPLADV-----ADVPADAFVAPNHEDCAFCARRWDVQQQALADAQDI
2461|gene|hut       DIPVGTIVVNRVMEDLADV-----ADVDADWYVSPNLETCEFCQRRWDVQQQALQRSQDV
10678|gene|hma      NIPVSTVVVNRVMQDPSEV-----LGEDVD-IAGPNHADCEFCARRWQVQQDALARSQDM
1331|gene|hhi       NIPVSTVVVNRVMQDPSEV-----LGEDVD-IAGPNHADCEFCARRWQVQQDALARSQDM
661|gene|hla        GIPVNTLVVNRVMEGVGDVTDGSGAAIDPEWVVEPNPDSCEFCARRWEVQQAALRRATDL
1236|gene|hwa       EIPVQTLIVNRVMEDLVDVTEIN-ADVDSEWVVSPNPSDCAFCQRRWNVQQTAIQRATDL
24910|gene|hbo      GIPVQTLVVNRVMENLADVTT---TPVDSEWVVSPNLDECEFCQRRWTVQQNALQRATDL
38790|gene|hbo      SVPSDCVVVNRVFEN-------------------PDGCRCDRCQRDAERHRDRIEAVEER
839|gene|hhi        EVPVTTLVVNKVIEDAGD---------------------CQRCQGKQAVQEEAIAQLRES
                     :*   ::**.* :                         *  *      :   :      

1164|gene|nph       FRGREIKRVPLFAEPVHGEEMLGVVGACLD---
365|chp|nrc1        FRGHTVKRVPLLAEEVRGERPLRVVAACLA---
2461|gene|hut       FRGHDVRRVPLFADEVRGEQLLRVVSACLEE--
10678|gene|hma      FRGHDVRRVPLFAEEVRGERLLSVVAACLD---
1331|gene|hhi       FRGHDVRRVPLFAEEVRGERLLSVVAACLD---
661|gene|hla        FRGRDVKRVPLLAKEVRGEAALRVVAACLR---
1236|gene|hwa       FRGRDVKRVPLLAEEVRGWNALRVVAACLN---
24910|gene|hbo      FRGRNVKRVPLLADEVSGEDALRVVAACLA---
38790|gene|hbo      F-SVPINCVPQLEGEAQGVDALERLGSYLLA--
839|gene|hhi        LPDLDVWTIPDQSGEVTGLSALERVAGSLSAVE
                    : .  :. :*     . *   *  :.. *