HOG Organism Gene ID Name Annotation
aHOG2958 hwa HQ2253 hypothetical protein
aHOG2958 nph NP1866 hypothetical protein
aHOG2958 hma Hma_7074 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1866|hp|nph      ------------------------------------------------------------
7074|hp|hma      MGAQISRRCLPDRYLMTVDRIEVSHTAAEKADRYLTPGQLKTVLRDHTGYVCRRASPNHD
2253|hp|hwa      ---------------MSLDRIIITHTAAEKSERYLTQSQLKKVLRESTGYICRQASPNHD
                                                                             

1866|hp|nph      ---------MRGTFFGTDLDIVFTVEPDRIVVVTQMSQHANSLRGHFYEQVGTTAADAVA
7074|hp|hma      DLYPDNEFTLRGEFYGLPLDIVFAIESDHVAVITQMSQHSDSLRGQFYEYVGDTVKDAVE
2253|hp|hwa      GLYANNKFIMRGEFFGQSLDIIFAVEDDRVVVITQMSQHSDSLRGRFYEFIGSSVTTAIE
                          :** *:*  ***:*::* *.:.*:******::****.*** :* :.  *: 

1866|hp|nph      AVSN
7074|hp|hma      HARS
2253|hp|hwa      YTE-
                  .