HOG Organism Gene ID Name Annotation
aHOG2953 hwa HQ3619 urtA ABC-type urea transport systems,substrate-binding protein
aHOG2953 nph NP2004 abc10s urea/short chain-amides ABC transporter periplasmic substrate-binding protein 1
aHOG2953 nph NP6128 htr32 transducer protein htr32
aHOG2953 hma Hma_7122 livJ putative ABC transporter substrate-binding protein
MUSCLE (3.6) multiple sequence alignment


6128|gene|nph      MGPRGTILEKLGRSTLVSTGSVGGVGGLIGK--STVSGSRDDP-------ITLAVLENRS
2004|gene|nph      -----MRNPTVSRRKLLASGAAAAGIGLAGC--MGGNGGSDGP--------TVGILEDRS
3619|gene|hwa      -----MSDNRMSRRAVLATGAVGLGASLAGCSSSGGSGGGDGS---ESDTIKIGVLEDRS
7122|gene|hma      -----MNRSSVSRRQFLGASGAALVTGLAGC--SAGEGGTSTDTASSTDTLKIGVLEDQS
                             :.*  .:.:....   .* *      .*. .          .:.:**:.*

6128|gene|nph      GKFAELGTSKWQASRLAVEELNESGGALGRKIELIDPDPASDVKRYRQLTTEILEERDVD
2004|gene|nph      GNFQLNGTSKWQATRLAIEEINEDGGILGEEVEIVDPDPQSDNERYQELTERLILQDQVD
3619|gene|hwa      GNFSLVGTPKWRASKLAIDEINADGGIMGKQIELFDPDPQSDNERYQQLTSRLIRQENVD
7122|gene|hma      GNFALVGDPKAKASMLAIEEINANGGIDGKQIETFQRDPQSDNQRYQELTRTAINEENVD
                   *:*   * .* .*: **::*:* .**  * ::* .: ** ** :**.:**   : : :**

6128|gene|nph      AIWAGYASSEREVVRPITNAHRQLYFYTNQYEGGVCDRYTFPVGATARQQLGAVLPYLVS
2004|gene|nph      ALWAGYSSATREAIRPIINDEDQLYFYTTQYEGGVCDDTIFAVGSTARQQLGAVTPYLAD
3619|gene|hwa      ALWAGYSSATREAIRPTIDRNEQLYFYTTQYEGGVADEYTFCMGPTARQQLGSVVPYMIE
7122|gene|hma      ALWAGYSSATREAIRPIIDRNEQLYFYTTQYEGGVCDEFTFAVGPTARQQLGIVLPYLVE
                   *:****:*: **.:**  :   ******.******.*   * :*.******* * **: .

6128|gene|nph      EYGPKIFTIAADYNFGHLSSDWVEILAAENDAEVIGTEFVPLSETSFEWLVDRIEAADPD
2004|gene|nph      QYGEDIYIIAADYNFGQLSGDWVNVIAEENGYNIVGEEYIPLDESDFSSVINRIQAEDPD
3619|gene|hwa      NFGSDIYTIAADYNFGQLSADWVKVIADENDAEVIGEEFIPLSVQNFGSTISNIQDADPD
7122|gene|hma      EFGPDIYTIAADYNFGQLSADWVKVLANENDANVLGEEFIPLSESSFGSTINRIQEADPD
                   ::* .*: ********:**.***:::* **. :::* *::**.  .*   :..*:  ***

6128|gene|nph      FVMSMLVGDNHAEFFREKATRDLSMPIGTSTAMAQAFEHKRYEPPAFADVYAGVNYMEEL
2004|gene|nph      FIMSMLVGANHENFYDQRDSNDLMIPIGTSTTMAQGHEHIRYEPNAVTDVYAGVSYMEEL
3619|gene|hwa      FVMAILVGANHSSFWNQRTSAGLEIPMGTSTVMAQGYQHKRLEAPALKDVYGGFNYMEEI
7122|gene|hma      FVMSMLVGANHTSFYEQKASAGLDVPIGTSTAMAQGYEHRRLDAPAMANIYAGVNYMEEV
                   *:*::*** ** .*: :. : .* :*:****.***..:* * :. *. ::*.*..****:

6128|gene|nph      STQENT---TFVERFYEMFPDADYINQEAQNNYVSIHLYAKAVEAAGTTDQDAVIEQLES
2004|gene|nph      GDLREG--ENFVEDFYDRWPDANYLNQEAQNNYFSVYMWKEAVEEAGTFDQDAVIDVLEE
3619|gene|hwa      PTSRNE---DYVSRYYDKFPDAGYANEESINNYFSIYMYKQAVEEAGTTDQEAVRDVLES
7122|gene|hma      PTDSNTGDGGFVDRYFEMYPDAPYLNEEAETNYFSTYMYKKAVEQAGTTEQPEVIDALES
                       :     :*. ::: :*** * *:*: .**.* ::: :*** *** :*  * : **.

6128|gene|nph      GLSF---DAPEG----RVAIDGATHHINHTMRIARADEDHNIEFFNEQRIDETFLSQTV-
2004|gene|nph      GVEM---NAPSG----RIELDGATHHITHQMRVAHADENHDISFDAEQEIGPSFLREEVE
3619|gene|hwa      GMEITGDRSPEG----DISFQGPVHHMTHNMRVMRCDAEHNITVEDQRKIPEQFLSETV-
7122|gene|hma      GIELGTEEAPEAPEGETIRLDGATHHVDHHMWIMRADDDHNVEAVENRQIPETFLSETA-
                   *:.:    :*..     : ::*..**: * *.: ..* :*::    :. *   ** : . 

6128|gene|nph      ---GCDLREVAE--TTQYRPALFHQQGTFDSMHDALEDRVQDAHESEKLREQLEARTQAY
2004|gene|nph      GGDGCDLRAESK--TTQYEPA---------------------------------------
3619|gene|hwa      ---GIDLSGEDDGMTKQFTPV---------------------------------------
7122|gene|hma      ---GCNLPENPE--QTQYTPV---------------------------------------
                      * :*    .   .*: *.                                       

6128|gene|nph      SDAMRAAAEGDLTTRMSTGANNEALAVIAEEFNEMIAEMERTLADIGEFADDVASASREV
2004|gene|nph      -----------------------------------------------DVYGDILE-----
3619|gene|hwa      -----------------------------------------------EYFDEAGS-----
7122|gene|hma      -----------------------------------------------DYYEEAE------
                                                                  :   :        

6128|gene|nph      TTSTDEVRATSESVASSIDQISDGAADQNESLQVVNDEMSDLSATIEEVAATTDEVADVA
2004|gene|nph      ------------------------------------------------------------
3619|gene|hwa      ------------------------------------------------------------
7122|gene|hma      ------------------------------------------------------------
                                                                               

6128|gene|nph      AKTAAAGSHGQEAATDAIAGMNETEQKAEQAVDAIHELEAEVTEIDALIDQISEIAEQTN
2004|gene|nph      ------------------------------------------------------------
3619|gene|hwa      ------------------------------------------------------------
7122|gene|hma      ------------------------------------------------------------
                                                                               

6128|gene|nph      ILALNANIEAARTGGDGESNGDGFAVVANEVKELSEEVKQAAESAESRVEAIQERTDRST
2004|gene|nph      ------------------------------------------------------------
3619|gene|hwa      ------------------------------------------------------------
7122|gene|hma      ------------------------------------------------------------
                                                                               

6128|gene|nph      TAVEATSERIAGASEQVTEAVEALEEIAAYADETNDGIQEISNTTEDQATSTEETVSMID
2004|gene|nph      ------------------------------------------------------------
3619|gene|hwa      ------------------------------------------------------------
7122|gene|hma      ------------------------------------------------------------
                                                                               

6128|gene|nph      EVASISEETTTEAESVAAAAEEQSASLAEVSASATELSERAAELSEAISRFEVGADLDDD
2004|gene|nph      ------------------------------------------------------------
3619|gene|hwa      ------------------------------------------------------------
7122|gene|hma      ------------------------------------------------------------
                                                                               

6128|gene|nph      AVDTSGAAEPGVSD
2004|gene|nph      --------------
3619|gene|hwa      --------------
7122|gene|hma      --------------