HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0294COG1467KOG2851arCOG04110Eukaryotic-type DNA primase catalytic (small) subunitDNA primase.Eukaryotic type

HOG Organism Gene ID Name Annotation
cHOG0294 nrc1 VNG1470 pri1 DNA primase.Eukaryotic type
cHOG0294 hmu HMUK2482 Hmuk_2482 DNA primase, small subunit( EC:2.7.7.- )
cHOG0294 hma RRNAC0292 pri1 DNA primase small subunit
cHOG0294 hwa HQ2719A priA DNA primase small subunit
cHOG0294 hla HLAC1798 Hlac_1798 DNA primase, small subunit
cHOG0294 hbo HBOR11510 Hbor_11510 DNA primase small subunit( EC:2.7.7.- )
cHOG0294 hut HUTA2753 Huta_2753 DNA primase, small subunit
cHOG0294 hvo HVO_2697 HVO_2697 DNA primase eukaryotic-type small subunit putative
cHOG0294 nph NP3990A priA DNA primase small subunit
cHOG0294 hhi 1034 pri2 DNA primase small subunit
MUSCLE (3.6) multiple sequence alignment


1798|gene|hla       ---------------------------------MDDRTREYLKGRFGDYYRRASPALPPD
2719|gene|hwa       ---------------------------------MEDRTRTYLKGRFGDYYARARMDTPPA
11510|gene|hbo      ---------------------------------MEAHTREYLEGRFGDYYRGADVALPPT
1470|gene|nrc1      MHRAPGRFVRPRRAVDPGETTLIYPRSAYCRPDMEERTRAYLRGRFGDVYRRAEIDLPPR
3990|gene|nph       ---------------------------------MNGRTREYLKGRFGDHYRRASLSPPPA
2753|gene|hut       ---------------------------------MEERTRAYLRGRFGDYYRRTEPLPPPD
10292|gene|hma      ---------------------------------MEERTRAYLRGRFGDHYRQASVTPPPA
1034|gene|hhi       ---------------------------------MEERTRAYLRGRFGDHYRQASVTPPPA
                                                     *: .** ** ***** *  :    ** 

1798|gene|hla       ANLREWGHIPWTPGSGTTMLRHQSLYDL---GDVDTFFADNAPRHAYFSAARYDDPGAST
2719|gene|hwa       ANRREWGHIPWSAG-STTMVRHQSLLEL---GTLDDFLHRTAPKHVYFSAARFNDPGATT
11510|gene|hbo      PERREWGYIPWSAG-GTTMVRHQSLLDI---GNLGDFLTRTAPQHVYFSAARFNDPGAGT
1470|gene|nrc1      ADDREWGYIPWTAGPDTTMVRHKSTLDL---GSMTSFLERKCPRHVYFSAGTYDAPGAAT
3990|gene|nph       ANEREWGYITWGDG-GTTMVRHHSYLDVTGGGDLGGFLAGERPRHVYFSAGRYDDPGASS
2753|gene|hut       AHEREWGYIPWTDSPGETMVRHQSLLDM---GDLESFLARERPRHVYFSAGRYTDPGAGS
10292|gene|hma      ANEREWGFIPWTEGPGETMVRHRSLLDL---GEIEDFLGRRKPRHVYFSAGRYDEPSAST
1034|gene|hhi       ANEREWGFIPWTDGPGETMVRHRSLLDL---GEIEDFLGRRKPRHVYFSAGRYDEPSAST
                    .  ****.*.*  . . **:**.*  ::   * :  *:    *.*.****. :  *.* :

1798|gene|hla       MSQKGWRSADLVFDLDADHLPGVDPDATSYPEMLAECKQALLRLLDFLEDDFSFDDLTVV
2719|gene|hwa       MDQKDWQSADLIFDLDADHLPGVNPDTTSYADMLTACKTELQTLLEFIDDDFNFDETQVV
11510|gene|hbo      MDEKGWQSADLVFDLDADHLPGVDPETTSYADMLAACKDDLLSLLDILENDFDFTDTQVV
1470|gene|nrc1      MDEKHWQGSDLVFDLDADHLPRVTLGEDSYAEMLSKCKDALLRLLDFLERDFGFEELTVT
3990|gene|nph       MGQKGWRGSDLVFDLDADHLPGIDPSETSYAAMLEACKGALSRLLDLLVEDFGFEPLAVV
2753|gene|hut       MSAKDWRGSDVVFDLDADHLPSVDPTQATYAEMLAACKDALFRLLDFLENDFGFEDLTIV
10292|gene|hma      MSDKGWRSSDLVFDLDADHLPSVVLGEDSYAEMLAKCKDALRRLLDFLEDDFGFDDLTIV
1034|gene|hhi       MSDKGWRSSDLVFDLDADHLPSVVLGEDSYAEMLAKCKDALLRLLDFLEDDFGFEDLTVV
                    *. * *..:*::********* :     :*. **  **  *  **:::  **.*    :.

1798|gene|hla       FSGGRGYHVHVRDESVRELDSEARREVVDYVRAIDLDTEGLIRTVSERGTT-------KR
2719|gene|hwa       FSGGRGYHVHVRDEQVRSLDSAARREIVDYIRAIDLNIETLIETQSNHGTT-------QR
11510|gene|hbo      FSGGRGYHVHVRDENVRELDSDARREIVDYVRAIDLDVEGLIGTESNRGTT-------RR
1470|gene|nrc1      FSGGRGYHVHVRDAGVYELGSEERREIVDYVRGNDLALETLVEAEPVGGRG-LENPTEKR
3990|gene|nph       FSGGRGYHVHVRRDDVLELDRTARREIVEYVLGEGLDFDDIVSTQAVAGSAGRSSPAQKR
2753|gene|hut       FSGGRGYHVHVRDDGIQQLEREARREIVDYVRGIGLDLDGLVTTEMRGNVT-------AR
10292|gene|hma      FSGGRGYHVHVRDERIRHLERDARREVVDYVRGIGLEFDELVDEESVAGTAGRSSPAQKR
1034|gene|hhi       FSGGRGYHVHVRDERIRHLERDARREIVDYVRGIGLEFDELVDEESVAGTAGRSSPAQKR
                    ************   :  *    ***:*:*: . .*  : ::      .          *

1798|gene|hla       VLRTEGGWGARVHEALIEYADDLREMDAEDARERLMELDGIGEGRAETILGAFDRNPTAV
2719|gene|hwa       ILKHRGGWGQRIHKRLVELIETLQASDDTEALERLQSFEGIGTGRAETILGQIQNNPEAI
11510|gene|hbo      VLRRHGGWGARVHDRLLELAENLREMEEEAALERLQELQGIGEGRAKTILGQIHNNFEAI
1470|gene|nrc1      MLPADGGWGRRVTTRLEAFADDLIERGEDDAVATLTEFDGVGERSARAIYNVVADNTTAV
3990|gene|nph       TLP-DGGWAGRVRTRLTTLFDEVLTMEEAAALDRLREFDGIGEGKAKAALTAARNNREEL
2753|gene|hut       TLRTEGGWGKRVHEALLAFVDEVEALPEEQAMTRLQDLEGIGEGRAKTIRGAIEENREAI
10292|gene|hma      TLSTEGGWSARAHRHMLAVVDDLLAMEEADALEQLQEYDGIGEGKATAALNAARSNYEQL
1034|gene|hhi       TLSTEGGWSARAHRHMLAVVDDLLEMDEADALEQLQEYDGIGEGKATAALNAARSNYEQL
                     *   ***. *    :    : :       *   * . :*:*   * :       *   :

1798|gene|hla       REGNVEAGGPGVRRLVSALAARVTATDTAPIDEPVTTDTRRLIRLPRTLHGGSGLVVTPI
2719|gene|hwa       HAGNLEAGGAGIRILADALAQTAFEAETAPIDEPVTTDTNRLIRLPGSLHGGSGLLVTPL
11510|gene|hbo      REGNVEAGGPGTRILVNALAEEAVTAETAPIDEPVTTDTKRLIRLPGSLHGGSGLRVKTL
1470|gene|nrc1      KRGNVDV-HPAFLTVARRYIDETVAAEQAPIDEPVTTDTNRLIRLPGSLHGGSGLEVQRL
3990|gene|nph       TKGNVDV-HPAVYSIARELFETVVEAESAPIDEPVTTDINRLIRLPGSLHGGTGLEVQHL
2753|gene|hut       EDGNMEAGGPGIRKLVEAITGDVIEGQNAPIDEPVTTDTNRLIRLPGSLHGGSGLAVRKL
10292|gene|hma      EAGNIDV-HPAFYQLAKILLHEVVAADNAPIDEPVTTDTNRLIRLPGSLHGGSGLEVQRI
1034|gene|hhi       EAGNIDV-HPAFYQLAKILLHEVVAADNAPIDEPVTTDTNRLIRLPGSLHGGSGLEVQRI
                      **::.  ..   :.      .   : ********** .****** :****:** *  :

1798|gene|hla       DRDDLDAFDPLRDAVPDRFVGREIRIETDVDRTVELNGERVRVEPGRNTVPEFAGVFLMA
2719|gene|hwa       DREEIPSFHPLEHAIADRFRGRDIQIRITDSGVTTFDGETFDITEGNKTVEECLGIFLMA
11510|gene|hbo      ERDEVADFDPLEDAIPDRFRGEKIKIRVTEPGPVEFDGDSFTLSAGDQSVKECLGVFLMA
1470|gene|nrc1      DRAALDDFDPLVDAVPETFVGHDITVELPTEHTVELRGESLTVGPGVSTVPEYAGVFMMA
3990|gene|nph       DRDAIDAFDPLSDAVPETFVGNEIAIYTQEPTTVELRGESFRLSEGVSSVPEYVGVFAMA
2753|gene|hut       SRDELAEFDPLVDAVPETFVGHEITVEVTAPGTVELGGDSFTLPEGVTSVPEYLGVFLMS
10292|gene|hma      DRDDLDAFDPLVDPVPETFRGHDITVEVTDGGLVELDGDSFTLEAGNQTVPEHVGVFLMA
1034|gene|hhi       DRGDIDAFDPLVDTVPETFRGHDITVEVTDGGLVELDGDSFTLEAGNQTVPEHVGVFLMA
                    .*  :  * **  .:.: * * .* :       . : *: . :  *  :* *  *:* *:

1798|gene|hla       RGEARKAPER
2719|gene|hwa       RGRAEKVTE-
11510|gene|hbo      RGRAEKETK-
1470|gene|nrc1      RGTAEKATE-
3990|gene|nph       RGYASKAGE-
2753|gene|hut       RGRAEKGQE-
10292|gene|hma      RGRAEKGKE-
1034|gene|hhi       RGRAEKGKE-
                    ** * *  :