HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0292COG0303arCOG00216Molybdopterin biosynthesis enzymemolybdenum cofactor biosynthesis protein

HOG Organism Gene ID Name Annotation
cHOG0292 nrc1 VNG0090 moeA1 molybdenum cofactor biosynthesis protein
cHOG0292 hmu HMUK2501 Hmuk_2501 molybdenum cofactor synthesis domain protein
cHOG0292 hma RRNAC1298 moeA2 molybdopterin biosynthesis protein moeA
cHOG0292 hwa HQ3345A moeA molybdenum cofactor biosynthesis protein MoeA
cHOG0292 hla HLAC2122 Hlac_2122 molybdenum cofactor synthesis domain protein
cHOG0292 hbo HBOR07190 Hbor_07190 molybdopterin molybdochelatase
cHOG0292 hut HUTA0037 Huta_0037 molybdenum cofactor synthesis domain protein
cHOG0292 hvo HVO_2304 HVO_2304 moeA Molybdopterin biosynthesis protein moeA.
cHOG0292 nph NP1440A moeA_1 molybdenum cofactor biosynthesis protein MoeA 1
cHOG0292 hhi 1890 moeA1 molybdopterin biosynthesis protein moeA
MUSCLE (3.6) multiple sequence alignment


37|gene|hut         --------------MSSD-RHEAGFKRQTPVTAAREQLRSVVTGVDRTEQIATEAAVGRV
1440|gene|nph       ---------------MAD-VRESGFKERTRVAAAREQLLD-IPPIDRTERISLSAADGRA
3345|gene|hwa       MVVMDSTDATDAGDASDPDRRSSGFKNRTKLAEARRQLLGDISPHERIDNLSLGQADSRV
7190|gene|hbo       -------------MTNAHDRQTAGFKERTRLADARETLLAAATPHQRTDTLPLGRVDGRS
90|gene|nrc1        --------------MTDD-RRTAGFKQRTRVAEARERLLSAVDPLARTARVALGDADGRV
2122|gene|hla       --------------MSHD-RREAGFKRRTRVADALATLLDAAEPHGRTESAPLADADGRV
11298|gene|hma      --------------MSNESRKSAGFKDRTPVTTARETLLDAVSPHERTERVPLRDADERV
1890|gene|hhi       --------------MSNESRKSAGFKDRTPVTAARETLLDAVSPHERTERVPLRDADERV
                                        . :*** .* :: *   *        *    .   .  * 

37|gene|hut         IAEQVTPERAVPHYDRAAMDGFAVNAEETVGASERAPARLER----AEN-----MGPGRA
1440|gene|nph       LAAPVAARRNIPHYARAAMDGWAVRAEDTFGASDRSPAVLRP----GDS-----VGPNTA
3345|gene|hwa       LAEPITAPRAVPGYERAAMDGWAVQAHDTFGAGDRSPKVLQVADDTAESVPDTPVGPNEA
7190|gene|hbo       LAEAVTAANPVPNYDRAAMDGWAVRAEDTFGASDRSPSILRVAVSEAESDADAAVEPGSA
90|gene|nrc1        LAADVEAPRAVPHYERAAMDGFAVRAADTFGAGDRSPVVLDVG---TGS-----VGPGEA
2122|gene|hla       VAEPIDAPAPVPSYDRAAMDGYAVRAEDTFGASDRSPAVLRAVGTEADS-----IAPGEA
11298|gene|hma      VAGEITAERAVPHYRRAAMDGFAVRAEDTFSASQRSPASLRV----DEA-----VTTGTA
1890|gene|hhi       VAREITAERAVPHYRRAAMDGFAVRAEDTFGASQRSPASLRV----DEA-----VTTGTA
                    :*  : .   :* * ******:**.* :*..*.:*:*  *              : .. *

37|gene|hut         VGVHTGSELPEHADAVVRVEDVTERNDGLAVETAVAPGENVAPTGEDVAADATLFEPGDR
1440|gene|nph       VRVHTGSELPEGADAVVMVEATEQVGDELEVFDAVGAGENVGPIGEDVEDGQRLYEPGHQ
3345|gene|hwa       VRVHTGSALPDGANAVVMIEQVTQVGTEIEVFDAVTERENVAPIGEDVAESQSLYNPGHQ
7190|gene|hbo       VRVHTGSELPPGADAVVMVEHADVVGSELEVFDAVTEGENVGDAGEDVAEGQELFDIGHE
90|gene|nrc1        VRVHTGSELPAGADAVVMIEDAERRGDRVDVFAAAAGGANVAPIGEDVSDGQHLYDAGHR
2122|gene|hla       ARVHTGSAVPEGADAVVMIEQVETVADEVEAFDAVAEGENVGEAGEDVADGQRLFEAGHV
11298|gene|hma      ARVHTGSELPEGADAVVMVEETEVTGDSVTVFDAVAGGENVAPVGEDVEQGQTLYEDGHR
1890|gene|hhi       ARVHTGSELPEGADAVVMVEETEVAGDTVTVFDAVAGGENVAPVGEDVAEGQTLYEAGHR
                    . ***** :*  *:*** :* .      : .  *.    **.  ****  .  *:: *  

37|gene|hut         LRPSDLGLLKATGIEGVTAYQPPEIAVIPTGEEVVESDPGPGEIVETNGLVVIRLVERWG
1440|gene|nph       LRPSDLGLLKGAGIDTVEVAARPEVAVIPTGEELVQSDPDPGEIVETNRFTVSRLAERWG
3345|gene|hwa       LRPSDLGLLKSVGHDRVQVYERPTVGVIPTGEELVQSNPGPGEVVETNGLTVSHLANRWG
7190|gene|hbo       LRPSDLGLLKSVGRDEVTVYDRPTVGVIPTGEELVQSDPEPGEVVETNGLTVSRLVHRWG
90|gene|nrc1        LRPSDLGLLKSAGVDAVAVYERPTVGVLPTGEELVAADPGPGEVVETNGGTVAQYVSRWG
2122|gene|hla       LRPSDLGLLKSVGLDAAPVYERSTIAVIPTGEELVQSDPGPGEVIETNGLTVSRLVERWG
11298|gene|hma      LRPSDLGLLKSVGNDVVEVYERPTVSVIPTGEELVQNDPEPGQVIETNGQTVTQYVERWG
1890|gene|hhi       LRPSDLGLLKSVGNDTIEVYEQPTVSVIPTGEELVQDDPAPGEVIETNGQTVTQYVERWG
                    **********..* :   .   . :.*:*****:*  :* **:::***  .* . . ***

37|gene|hut         GDPRYRDIVTDDQQALADAIERDLD-ADVIVTTGGSSVGERDLLPEVVEDLGDVAVHGVA
1440|gene|nph       ADVTRRSIVTDDREALRAAVERDLT-RDVVVTTGGSSVGERDLIPEVVSDLGEVFVHGVA
3345|gene|hwa       GIATYRNVVTDDPAALRAAIQRDLT-KDVVVTTGGSSVGSRDLVPEIIDTLGSVLVHGVA
7190|gene|hbo       GVATYRNVVTDDPAALRAAVQRDLT-KDVVVTTGGSSVGERDLIPEVVDELGEVLVHGVA
90|gene|nrc1        GVPTRRGVVTDDEAALRTAIREAVDSHDVVVTTGGSSVGARDHVPEVIADLGTVLVHGVA
2122|gene|hla       GEARYRDVVTDDEDALSAAIEADLD-ADVVVTTGGSSVGERDLLPEVIDSIGEVLVHGVA
11298|gene|hma      GDATYRDIVTDDVDALRAAISDDLD-HDLVVTTGGSSVGERDLLPEVVSEIGEVLVHGVA
1890|gene|hhi       GTATYRDIVTDDVDALRAAISDDLD-HDIVVTTGGSSVGERDLLPEVVDGIGEVLVHGVA
                    .    *.:****  **  *:   :   *::********* ** :**::  :* * *****

37|gene|hut         HKPGHPVGFGRVEATPVLMLPGYPVSALVNAVQLLYPAVAWAGNREPEAPPTTAGELTRK
1440|gene|nph       LKPGHPVALGRVNGVTIVMLPGYPVAAIVNAVQFLRPLIKHLGRFPSEPLPSQAATLTRK
3345|gene|hwa       LKPGHPVALGIIEDTPVIILPGYPVAAIVNAVQFLRPILKYMGHLPCNSPPTTTAQLSQK
7190|gene|hbo       LKPGHPVALGVVEDTPVVMLPGYPVACIVNAVQFLRPLLKHVGHLDGRPYPSVEARLERK
90|gene|nrc1        LQPGHPVALCVVDDTPVVALPGYPVAAIVNAVQFLRPLLKAVGHAPATAHPTTDAVLARK
2122|gene|hla       LKPGHPVCLGVVDDTPIVSLPGYPVACIVNAAQFLRPLQKHVGGTTANPFPTRRATLTRK
11298|gene|hma      LKPGHPVALGVAEGTPILMLPGYPVACIVNAVQFLRPALRQAGHLRSTDPPTTKAELTRK
1890|gene|hhi       LKPGHPVALGVVEETPILMLPGYPVACIVNAVQFLRPALRQAGHLPSTAPPTTEAELTRK
                     :***** :   : ..:: ******:.:***.*:* *     *       *:  . * .*

37|gene|hut         IASEPGVRSYVRVRHV-------------------------AEGVEPIRSGGAGVLSSVS
1440|gene|nph       IRSEPGVRTFARVTLS-----PTDDGLEA----------------TPTRASGSGVLSSVA
3345|gene|hwa       IPSEPGVRTFARVRTETTTAADSDIDTDAYIDTNTDTKNVISTIAKPTRASGSGVLSSVA
7190|gene|hbo       IPSEPGVRTFARVRLREENDEGDNGGNDP-----------VERIAEPTRTSGSGVLSSVA
90|gene|nrc1        IASEPGTRSFVRVTRH-----GDEDG---------------RPTVTPTRAGGSGVLSSVA
2122|gene|hla       VPSEPGTRTFARVSVEGTGEGGDGDGDDS-----------ALPAATPTRASGSGILSSVA
11298|gene|hma      IASEPGTRTYARVELH-------DEDADE------------QTTATPTRASGSGVLSSVA
1890|gene|hhi       IASEPGTRTYARVELH-------DEGVDE------------QTTATPTRASGSGVLSSVA
                    : ****.*::.**                                 * *:.*:*:****:

37|gene|hut         AADGWVVVPESQEGIEAGATVSVEDWEWSP
1440|gene|nph       LADGWVVVPEQREGIPADETVAVQDWEHNV
3345|gene|hwa       LADGWVIVPESREGLDAGETVSVEQWEWST
7190|gene|hbo       LADGWVAVPEETEGYAKGETVTVEGWEWSA
90|gene|nrc1        LADGWVVVPEDCEGYDAGTTVAVEQWEWSA
2122|gene|hla       LADGWVVVPEPREGLDAGEIVDVELWEASQ
11298|gene|hma      LADGWVVVPESVEGYDAGDTVTVEDWEWSQ
1890|gene|hhi       LADGWVVVPESVEGYDAGDTVAVEDWEWSQ
                     ***** ***  **   .  * *: ** .