HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0029arCOG02980hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0029 nrc1 VNG2539 vng2539 no entry
nucHOG0029 hmu HMUK0201 Hmuk_0201 conserved hypothetical protein
nucHOG0029 hmu HMUK0200 Hmuk_0200 conserved hypothetical protein
nucHOG0029 hmu HMUK1266 Hmuk_1266 hypothetical protein
nucHOG0029 hma RRNAC2237 hypothetical protein
nucHOG0029 hma RRNAC2239 hypothetical protein
nucHOG0029 hwa HQ1059A hypothetical protein
nucHOG0029 hla HLAC2472 Hlac_2472 hypothetical protein
nucHOG0029 hbo HBOR04010 Hbor_04010 hypothetical protein
nucHOG0029 hbo HBOR04020 Hbor_04020 hypothetical protein
nucHOG0029 hut HUTA0973 Huta_0973 conserved hypothetical protein
nucHOG0029 hut HUTA0974 Huta_0974 conserved hypothetical protein
nucHOG0029 hvo HVO_1806 HVO_1806 lipoprotein putative
nucHOG0029 nph NP1172A hypothetical protein
nucHOG0029 hhi 2709 HAH_2709 hypothetical protein
nucHOG0029 hhi 2708 HAH_2708 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1172|hp|nph       --MDRRLLAATALAAVLLSAGCT----------------------------VGYQPAADA
2472|hp|hla       --MRRVLTLSVIVAVIALLSIGAGGAVAAGPAVAG-------------STAAIPGDAPAS
2539|hp|nrc1      --MARRLLA-VAVVCLVVLAGCQGGMSGDATTDPTTTAPTTEQMTDAAGTTTQPGANASF
973|chp|hut       --MRRRYTKILTALCVVVLAL----QPVTAATAMAGDVSTPAASESLTAADVAETGTNET
974|chp|hut       -MVSRTQIFVMVVGLALV--GVPVAAAAGSPNTAAAPDSSP-------TSTDLSNVTSDA
1059|hp|hwa       -MSRRISRASIALSLLIVLAGCSGGGSLFNPNVGEDSSSTESATAEGIGQENGTGPPVAV
4010|hp|hbo       -MLTKHGIAVGALSLLLVLAGCT--APMVEPELGDG------------GVAGGPSDTSVI
12237|hp|hma      --MRRPFALVILCAVALLLAGCQ--APSVSPDTESSN-----------AELTPSEPATDY
2708|hp|hhi       --MRRPFALVVLCAVVLLLAGCQ--APSASPETETGG-----------DDLTPSEPATDY
4020|hp|hbo       MNISRSSLVPVVLALSLIISGCS--APV-------------------------SDPSASW
12239|hp|hma      --MRKELLI----ALTVVLAGCT--VP-------------------------------SF
2709|hp|hhi       --MRKELLI----ALAVVLAGCT--VP-------------------------------SF
                      .            :                                          

1172|hp|nph       PPTSEPPAEPHP---GYHDGYWYNDTFDLDAEAGLTDPQVDAVTARAMARVQLLRGLEFE
2472|hp|hla       ATATECDAGDGTDLVGCWNGTHYEEELAFNQTDGLTEAELEELTHLTMARVEHVRERPFR
2539|hp|nrc1      SYDD-----PDADTLGWEGGYWYNESISVDRSDGLNDSELHTVVNRSMARVEVVRGLEFN
973|chp|hut       ISNETHPPDPEADVLGWENGYWYNETIDVTPEDGLNESELDAVVARSMARVEQIRQLEFE
974|chp|hut       TVADQHPPDPESDVLGWESGYWYNESIAVTPDDGLNDSELDAVVARGMARVEQIRRLEFE
1059|hp|hwa       ATPDSDFSDPAGDPLGWEAGYWYNESIEVDQADGLTDAEMKAYVGRAMARVEYLRQLEFK
4010|hp|hbo       ASPDANFTDPADDPLGWEDGYWYNESIAVDQSDGLSDTELRAYVARSMARVEYLRHKEFK
12237|hp|hma      GNNDSAPPAPATDQLGYENGYWYNESLSVTTEDGLNETEREAVVARTMARVERIRGLEFE
2708|hp|hhi       GSNDSAPPAPATDRLGYENGYWYNESLSITTGDGLNETEREAVVARTMARVERIRGLEFE
4020|hp|hbo       SWPEDPPT----DRIGWEEGYWYNESIAVNQSDGLNETELDAFVARTMARVEHVRQLEFR
12239|hp|hma      GGSDHPATPTGDDAIGYESGYWYDDSVSVTTGDGLNETEREAVVARTMARVEQVRDLEFK
2709|hp|hhi       GGSDHPATPTGDDAIGYESGYWYDDSVSVTTDDGLNETEREAVVARTMARVEQVRDLEFK
                                 *   * .*:: . .    **.:.:    .   ****: :*   * 

1172|hp|nph       SDVDVELLTREAFQAEY-----GDVWGDPPADAQTLDNVQHEALFLVESDEDVTDARAVN
2472|hp|hla       EDVPVETVTRSAFMNDS----ASAGAGGSDPEFHRWNDQVWKALFVVGEDENASDAIDSV
2539|hp|nrc1      QSVPVDVISREEFANDT-----AASYENVTRNGTLHQNVKWEAMFMVGEDENAIDVLASN
973|chp|hut       ETVPVEVISREEHSEQI-----TNRSTNATTAQRLSANVIYEALFMVNESANAVRNVEQN
974|chp|hut       ETPPVEVISRENYTERV-----GNQTASVTTAQRLHQNVKYEALLMINESTDAIAAQERN
1059|hp|hwa       SSVPVSVISRSEYRSQR----DESTRSSENQEFQQWNNQVWEALFAVGESESTQQAIEET
4010|hp|hbo       KRVSVDILSREEYQEQQRANAQNGSAAGNQTEFNQWNNQVWEALFISGESGDSQAEISET
12237|hp|hma      ETVPVSVISRSEYRNNT----GGGETGDSLRRFD---NVKFEALFFIGEDRDSIAVQNSN
2708|hp|hhi       ETVPVSVVSRAEYRNNT----GGGETGDSLRRFD---NAKFEALFFIGEDRDSIAVQNSN
4020|hp|hbo       EEVPVEVISRKEYRNEA---------NVFRAEPDSWQEQVYEASFLIGEDESVADVLNGL
12239|hp|hma      EPVPVSVISRAEYQNRS----GGNNSGGSSRPQDPWNDQVWEALLLIGEDSGSSDEIDDT
2709|hp|hhi       EPVPVSVISRAEYQNRS----GGNEGGGSSRPQDPWNDQVWEALLLIGEDSGSSDEIDDT
                  .   *. ::*  .                        :   :* :   .. .        

1172|hp|nph       RGDTVLGFYQPTTERLVVVSENDPATFDDEMTLAHELLHALQDQHFGLEDVG--DGTIDG
2472|hp|hla       YGGAVSGFYSPADDRIVLVVPEGEDPQINPSTLAHELVHAMQDQYHDLTRPRYVGTTQDA
2539|hp|nrc1      RAGSVLGYYSPSEDRIAIVSEDTESPQMDEITLSQELFHGLQTHRFNTSELN--QSTQEL
973|chp|hut       QANWR-GYYDPSAGEIKIISANASTPKMDEIVLSQELFHALQDQRFNLSSFN--GPTQEL
974|chp|hut       QAGGVGGFYDPSNGEIKIVSENATTPKMNEITLSQELFHALQDQQFNISSFN--QSTQEL
1059|hp|hwa       RGSSVAGFYDPRDDAITIVTDTPDTPTIENTTLIHELVHAVQDQQYDLTKDRYAATTQDG
4010|hp|hbo       QGSSVAGFYSPSNDAITVITPSPDSPRIDNATLIHELTHALQDQHYDLTSQTYRGDTQDR
12237|hp|hma      RGESVLGYYSSQRGEIVIVSDS-ETPTISRGTLAHELVHALQDQQFGLESD---ARTRDQ
2708|hp|hhi       RGESVLGYYSSQRGEIVIVSDS-ETPTISRGTLAHELVHALQDQHFGLESD---ARTRDQ
4020|hp|hbo       YGGAVAGYYTPGDDQIVIVSNS-EQPKINRVTLAHELVHALQDQQFGFNPP---QETHDA
12239|hp|hma      LSTTVQGYYSPSEDEIVIVSPT-ETPQIDRRTLSHELVHALQDQHFGLNGS---AETQDT
2709|hp|hhi       LSTTVQGYYSPSEDEIVIVSPT-ETPQIDRRTLSHELVHALQDQHFGLNGS---AETQDT
                   .    *:* .    : ::      .  .  .* :** *.:* : ..         * : 

1172|hp|nph       TNARNGLIEGDAVVIETEYEARCETDEW--QCLGTDDDGGTVGVPA---------AFNWG
2472|hp|hla       DLAVDGIVEGEAVHIEEVYDARCA-GNW--SCLAAPDSGGGGGSAA---------DYNFG
2539|hp|nrc1      HNAKDGIIEGDGNYVDHRYQQRCE-RDW--DCL-RPTDSESPSGS----------DRHTG
973|chp|hut       RNANDGIIEGDANYVDYRYQERCE-NEWSGTCI-VPERSQSGSNS----------DTHVG
974|chp|hut       HNAKDGIIEGDGNYVDRLYQQRCE-GEWQGDCI-MPGESQTPANF----------SPHIG
1059|hp|hwa       QLATDGLIEGDARYVESAYGDRCG-SSW--ECVELPDDTGEDSGSSGG-------PSNLG
4010|hp|hbo       SLAIDGAVEGDAKYVELLYADRCG-IEW--ECVETPPATGAGGSAGSAGN-----GPNLG
12237|hp|hma      VQGRNGVVEGDAVAVTQTYTDRCG-AAW--RCIDRPAQSGGGGG-----------DRHFG
2708|hp|hhi       VQGRNGMVEGDAVAVTQTYTDRCG-EEW--RCIDRPAQSGGGGG-----------DRHFG
4020|hp|hbo       RIADNGLYEGDAKYTESLYEERCA-DDW--DCVPIPPAGAGGGA-----------SFDFG
12239|hp|hma      QLSRQGVTEGEANYVRILYERQCG-DGW--GCIAFPDQTSDGGGNDGGDGDSQEPSYNEG
2709|hp|hhi       QLSRQGVTEGEANYVRILYERRCG-DGW--GCIALPDRTSDDGGSSDGDDASQQPSYNEG
                    . :*  **:.      *  .*    *   *:         .                *

1172|hp|nph       LYVLDFFPYTAGPPFIDHHRERGGWSAVDAAYDAPPTASAEVIYPETYGSGTYGEARIED
2472|hp|hla       ILQTVLQPYADGALYAETLVDEEGWSAVNETMNRPPNATSEVIHRN--PDYETTEVTFED
2539|hp|nrc1      IALTRLQPYSDGPVFVEQLYESGGWDAVNDVYENPPASTEQTIHPDRYGVDEPTPVSVAD
973|chp|hut       LYQIFLQPYADGPAFVRDLHQSEGWDAVNAVYENPPASTEQTIHPEKYGEDEPSPVPIED
974|chp|hut       LYQITLQPYSDGPAFVRDLHQSEGWDAVNAVYENPPASTEQTIHPEKYGEDEPSPVPIED
1059|hp|hwa       IFVTIFQPYSDGVGYINHLRESGGWDAVNDRFKSPPVASEQVIHRT---DETPQPISYTD
4010|hp|hbo       IFLTIFQPYSDGPVYVHDKVQQGGWQAIDELLRNPPESTEQTIHST---DEKPVPIEYQD
12237|hp|hma      INFMKYFPYSDGPGLIGNLRDRGGWSTVNDAYDDHPDGATEVTYPERYPEWEPESVSLAD
2708|hp|hhi       INFMQYFPYSDGPGLIGALRERGGWSAVNDAYDDYPDGAAEVTYPERYPEWEPESVSLAD
4020|hp|hbo       VYLTIYAPYSEGPEFVAALHERGGWKAVNDAYDNIPTTAEQIWHPEKYPDEGPTNADVPD
12239|hp|hma      LFTVLYQPYVTGPRFVDQVRSDGGWDAVDALHDDFPDSTEQVLHPEKYPDEEPVNVSVAD
2709|hp|hhi       LFTVLYQPYVTGPRFIDQVRADGGWDAVDALHDDFPDSTEQVLHPEKYPDEKPVNVSVAD
                  :      **  *           **.:::      *  : :  :               *

1172|hp|nph       QPRNGWQRVTVDNGTD---HARVGQAGLVAMF---------------------ARTAYDD
2472|hp|hla       TATGGWETY-PNQGVN--GSETAGEASMFVMF---------------------WYQSYEY
2539|hp|nrc1      TSTDAWTV--PETGNDSVDFASFGEAGLFTML---------------------WYPSYVE
973|chp|hut       TSDDRWRPLDINASIN---YASFGEAGLFVAL---------------------WYPGYES
974|chp|hut       TSDDRWRPLDINASIN---HASFGEAGLFVTL---------------------WYPGYES
1059|hp|hwa       RSSAKWERF-ESVGQD--GSDTVGEASIFVMF---------------------WNQARTV
4010|hp|hbo       RSTNGWATF-PQQGQD--GSDTVGEVSMYAMF---------------------WYQARMS
12237|hp|hma      RSSDDWERVRPSTDRDRPDYAVVGPSAIAGSMAYTIADDYNASSVVQTGDVINYEDGSLD
2708|hp|hhi       RSSDDWERVRPSTDRDRPDYAVVGPSAIAGSMAYTIADDYNESSVVRTRDVINYEDGSLD
4020|hp|hbo       RSSTEWSRFDRETVTT-----RLGEAYLYVML---------------------WDTRAID
12239|hp|hma      RSSDEWSRFDHDPVGD-----TVGETSIYAMM---------------------YHNGQTE
2709|hp|hhi       RSNEEWSRFDHDPVGD-----TVGETSIYAMM---------------------YHNGQTE
                   .   *     .           *   :   :                            

1172|hp|nph       RASGVVPHTAFT-------------GDDTRYTYDIEYADGWTGDRLHAYQ----------
2472|hp|hla       RHAVLDPDATIRDNIQIHTQPDERLRTRANYNYAHEATDGWAGDELYPYRNDGNADGDDA
2539|hp|nrc1      TQATGQPADVVIPTTHLLAPARNN-DTLDLYNYSHPYTDGWDGDKLVPYA-------ASD
973|chp|hut       Q----LSTEIIPYRDHVNIGADGALDEFDPYDYDHRYTAGWDGDKLLPYV-------TEE
974|chp|hut       S----TATQIIPYRAHLNIGADGL-NELDPYNYNHTYTNGWDGDKLLPYV-------TEE
1059|hp|hwa       GAETVRPQTLTQPT-----------NQYDAYNYIADPSTGWENDRLFPYQTQNGVSTESE
4010|hp|hbo       GAETIPSQSILRTE-----------SQYDTYNYDAAPSNGWGNDRLFPYK--------NS
12237|hp|hma      S--------------------------DDPYNYDLPATDGWQGGRMHVYA----------
2708|hp|hhi       S--------------------------DDPYNYDLPATDGWQGGRMHIYD----------
4020|hp|hbo       RQSLRQAT-----------------GQYSRYNYTSGASAGWGGDTLVPYR----------
12239|hp|hma      G---------------------------DRYSYESEISAGWGGDLVVPYR----------
2709|hp|hhi       G---------------------------DRYSYESEISAGWGGDLVVPYR----------
                                                * *    : ** .. :  *           

1172|hp|nph       --RDNETAYRWNVTFENADEAATFRRGYERVLDY--WGGEET------------AD---G
2472|hp|hla       SATDGEDGYVWVTEWQTPADATEFREAYLRMLTA--HGGDDH------------AA--GE
2539|hp|nrc1      SLNTSETAYVWASTWDSASDATEFADAYRELLQY--HGAERV------------SDAGPN
973|chp|hut       SSETNETGYVYKTVWDSPDDAEEFQNGYEQLLAF--HGAESV------------EG-HEN
974|chp|hut       SSETNETGYVYRTAWDSPTDAEEFQNGYEQLLAF--HGAESV------------DD-HEN
1059|hp|hwa       SESESEYGYVWVTTWESNEDATEFRNAYRSILTA--RDATTPQRVESENTGSTAKTAKTT
4010|hp|hbo       VNGSDEYGYVWVTEWDSKGDAQQFYDAYVNILDA--HDATKQ------------SK---N
12237|hp|hma      --SGDETAYVWKTTWASEADAREFADAWAAVIAH--WGGTRT------------AE---G
2708|hp|hhi       --NGDETAYVWKTTWDSEADAREFADAWEAVIAH--WGGTRT------------AE---G
4020|hp|hbo       -SESGEFGYVWAIEWDTEADAEQFDERYRKLLLQLRMNAERI------------DS---E
12239|hp|hma      -NGSGGYGYVWETRWDTEEDASEFAQAYRAALTE-EHDAGQP------------RS---N
2709|hp|hhi       -NGSGGYGYVWETRWDAEEDASEFAQAYRAALTE-EHDASQP------------RS---N
                      .  .* :   :    :*  *   :   :     ..                     

1172|hp|nph       HWRFDGAAG--FEKTVSVSDADASVRVVGAPTPEAVGDISPAVAPNA-------------
2472|hp|hla       VYEIA-DGD--FRGAYGVERNGTTVTIAHAPEPADVLDLRPEADLELSSTDDGDDANRTD
2539|hp|nrc1      VWRIPDDSDSGYADAFRVTTTEGRVTIVNAPTVDQLDAVHDSS-----------------
973|chp|hut       VYRIPEGEE--FDDAISLNRTGETFTIVNAPSVDELSAVREGATPEVEESTESDETTETD
974|chp|hut       VYRIPDGEG--FNDAFYLDQSGETLTIVNAPTLAELSGVDVSA-PQIEESTETTPDDGTT
1059|hp|hwa       TYVIPDGS---YADAFRVTQDGTQVTIVNGPNVTSLDNIRAQSKPSSA------------
4010|hp|hbo       TWVV-ESGQ--FADSFRVQQDGTRVTIVNGPTVEDVDDIRPPAN----------------
12237|hp|hma      HWVIEEGSP--YTDAVSVRVNGDTVTVVNAPTADELREVHDA------------------
2708|hp|hhi       HWVIEEDSP--YTDAVAVRVDGETVTVVNAPTADELDEVHDA------------------
4020|hp|hbo       TYVI-RDGP--FADAFRVQQNGTRVTIVNAPSVEALDRVHASG-----------------
12239|hp|hma      VYVVPEESQ--FNDAFRVVRSGKTVRIVNGPTVNNLDEIHQPAG----------------
2709|hp|hhi       VYVVPADDQ--FNDAFRVVRSGKTVRIVNGPTVSDLDEIHQPAES---------------
                   : .       :  :  :      . :. .*    :  :                     

1172|hp|nph       ------------------------------------------------------------
2472|hp|hla       GDDGTDGDDADGTNDGTDSDDGDDIDPDGDDADGSAG-------------------SDAA
2539|hp|nrc1      ------------------------------------------------------------
973|chp|hut       GSTTDTDETTETDKSTESDTATDEPDSTTESGDETADESETAESPTTESQDETDEQSTET
974|chp|hut       TEADDDEPTTDDSEDETTTSDGETTTDEPDDSETTQS--------------TDTDDSTDA
1059|hp|hwa       ------------------------------------------------------------
4010|hp|hbo       ------------------------------------------------------------
12237|hp|hma      ------------------------------------------------------------
2708|hp|hhi       ------------------------------------------------------------
4020|hp|hbo       ------------------------------------------------------------
12239|hp|hma      ------------------------------------------------------------
2709|hp|hhi       ------------------------------------------------------------
                                                                              

1172|hp|nph       ------------------------------
2472|hp|hla       TGDDVPGFGPLVALVGILATVALFVRRVRP
2539|hp|nrc1      ------------------------------
973|chp|hut       TTASGPGFTFGAAVVALVALIGTARRID--
974|chp|hut       TTTNGPGFVATSALIGLLAVALLALRRR--
1059|hp|hwa       ------------------------------
4010|hp|hbo       ------------------------------
12237|hp|hma      ------------------------------
2708|hp|hhi       ------------------------------
4020|hp|hbo       ------------------------------
12239|hp|hma      ------------------------------
2709|hp|hhi       ------------------------------