HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0289COG0060KOG0434 KOG0433arCOG00807Isoleucyl-tRNA synthetaseisoleucyl-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0289 nrc1 VNG2190 ileS isoleucyl-tRNA synthetase
cHOG0289 hmu HMUK1055 Hmuk_1055 isoleucyl-tRNA synthetase( EC:6.1.1.5 )
cHOG0289 hma RRNAC2634 ileS isoleucyl-tRNA synthetase
cHOG0289 hwa HQ2671A ileS isoleucyl-tRNA synthetase
cHOG0289 hla HLAC0887 Hlac_887 isoleucyl-tRNA synthetase
cHOG0289 hbo HBOR16810 Hbor_16810 Isoleucyl-tRNA synthetase( EC:6.1.1.5 )
cHOG0289 hut HUTA1825 Huta_1825 isoleucyl-tRNA synthetase
cHOG0289 hvo HVO_1547 HVO_1547 ileS isoleucyl-tRNA synthetase
cHOG0289 nph NP0610A ileS isoleucyl-tRNA synthetase
cHOG0289 hhi 3050 ileS isoleucyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


887|gene|hla        --------------MDDIDDQYTPADVESAVDEYWDESDAYDSAKEAHADDPPFFFVDGP
2671|gene|hwa       --------------MDEVDDQYTPADVETAIETYWDDTNAYEATKEAHADDPSFFFVDGP
16810|gene|hbo      --------------MDDLSDQYTPADIESVVGDYWDEENAYEATKEAHADDPAFFFVDGP
2190|gene|nrc1      -----------MSGFGDVPDQYDPAGVEERVFSYWEAVDAYEQTVDHRADAETFFFVDGP
610|gene|nph        -----------MSRFAEVDDQYDPDAVEDRVFDYWDEVDAYERTVEHRADGEDFFFVDGP
1825|gene|hut       MTDVEDRDPPTYERFGEVADQYDPDSVRERVFAHWDAVDAYEQTKDHRADGEDFFFVDGP
12634|gene|hma      -----------MERFAAVDDQYDPDAVEDGVFEYWDDVDAYEQTKAHRADGEDYFFVDGP
3050|gene|hhi       -----------MERFAAVDDQYNPDAVEDGVFEYWDDVDAYEQTKAHRADGEDYFFVDGP
                                  :  : *** *  :   :  :*:  :**: :   .**   :******

887|gene|hla        PYTSGQMHLGTAWNKTLKDAIIRHKRMTGHRVTDRPGYDMHGLPIEVKVEEELGFENKRD
2671|gene|hwa       PYTSGQMHLGTAWNKTLKDAIIRYKRMTGHHVTDRPGYDMHGLPIEVKVEEELGFETKRD
16810|gene|hbo      PYTSGQMHLGTAWNKTLKDAIIRYKRMTGHRVTDRPGYDMHGLPIEVKVEEELGFETKRD
2190|gene|nrc1      PYTSGAAHMGTTWNKTLKDAYIRYHRMQGYDVTDRPGYDMHGLPIETKVEEQLGFESKKD
610|gene|nph        PYTSGSAHMGTTWNKTLKDAYIRYHRMRGYNVTDRPGYDMHGLPIETKVEERLGFDNKKD
1825|gene|hut       PYTSGAAHMGTTWNKTLKDAYIRYLRMQGYDVTDRPGYDMHGLPIETKVEEKLGFENKKD
12634|gene|hma      PYTSGAAHMGTTWNKTLKDCYIRYLRMQGYNVTDRPGYDMHGLPIETKVEERLDFENKKD
3050|gene|hhi       PYTSGAAHMGTTWNKTLKDCYIRYLRMQGYNVTDRPGYDMHGLPIETKVEERLDFENKKD
                    *****  *:**:*******. **: ** *: ***************.**** *.*:.*.*

887|gene|hla        IEEYGMESFIEKCKEFALRNRAAMDEDFQSIGVWMDWDDPYETIDPEYMEAAWWAFSNVA
2671|gene|hwa       IEEYGMESFIEECKRFAVDNRKAMDEDFQSIGVWMDWDNPYETLSPEYMEAAWWAFQQVD
16810|gene|hbo      IEEYGMESFIDECKSFAERNREAMDDDFQSIGVWMDWDDPYKTLSPEYMEAAWWAFDQVA
2190|gene|nrc1      IQEFGEEAFIEECKRFADDNLDGLQSDFQSFGVWMDWDNPYKTVDPSYMEAAWWAFSEVH
610|gene|nph        IEEFGEQNFIDECKSFAEEQLEGLQEDFKSFGVWMDWDDPYKTVDPEYMEAAWWGFSKAH
1825|gene|hut       IQEFGEENFIDECKDFAEQQLEGLQEDFKSFGVWMDWDDPYKTLSPEYMEAAWWGFEQAH
12634|gene|hma      IEQFGEENFIEECKDFAEEQLEGLQTDFQDFGVWMDWDDPYKTVNPEYMEAAWWGFQQAH
3050|gene|hhi       IEQFGEENFIEECKDFAEEQLEGLQTDFQDFGVWMDWDDPYKTVNPEYMEAAWWGFQQAH
                    *:::* : **::** **  :  .:: **:.:*******:**:*:.*.*******.*.:. 

887|gene|hla        DNGLVEQGKRSISQCPRCETGLANNEVEYEDVEDPSIYVKFPLAD---------------
2671|gene|hwa       DRGLVERGKRSVSYCPRCQTAIAANEVEYDEITSPSIYVRFPLSN---------------
16810|gene|hbo      DRGLVERGKRSVNYCPRCQTAIAANEVEYDEIDSPSIYVKFPLED---------------
2190|gene|nrc1      DNGLVERGQRSISQCPRCETAIANNEVEYEDVTDPSIYVRFDLDD---------------
610|gene|nph        DRDLVEQGQRSISQCPRCETAIANNEVEYDHVEDPSIYVKFPLAE---------------
1825|gene|hut       EKGLVEQGKRSISQCPRCETAIANNEVEYEDVSDPSIYVKFSLTD---------------
12634|gene|hma      ERDLVEQGQRSINQCPRCETGIANNEVEYHDVGKPSIYVKFPLAE---------------
3050|gene|hhi       ERGLVEQGQRSINQCPRCETGIANNEVEYHDVGKPSIYVKFPLADREGERSETSERASGE
                    :..***.*:**:. ****:*.:* *****  : .*****.* * :               

887|gene|hla        ---REGSLVIWTTTPWTIPANTFVAVDEDLTYNAVRAER-DGESELIYVAADCVEDVLQE
2671|gene|hwa       ---KEGSLVIWTTTPWTIPANTFVAVDKDLTYQAVRAEQ-GDDSEVLYIAESCVEDVLKQ
16810|gene|hbo      ---REGSLVIWTTTPWTIPANTFVAVDGEMTYQAVRAEK-GGESEVLYLAEPCVEDVLKK
2190|gene|nrc1      ---REGSLVVWTTTPWTIPANQFVAVDEDGDYQQVRATTPDGETDVLYVASECVEDVLSA
610|gene|nph        ---REGHLVIWTTTPWTVPANTFVAVDEEMTYQAIEVDT-GDGTETLYVGEPCVEDVVDH
1825|gene|hut       ---REGSLVIWTTTPWTIPANTFVAVEEDLTYQGVEATK-DGETEVLWIAESCIEDVLSK
12634|gene|hma      ---QDGSLVIWTTTPWTIVANTFVAADGDLEYVGVDAEK-DGDTERLYLAEACVEDVLKA
3050|gene|hhi       TASREGSLVIWTTTPWTIVANTFVAVDGDLDYVGVDAEK-DGDTERLYVAEACVEDVLKA
                       .:* **:*******: ** ***.: :  *  : .   .. :: :::.  *:***:. 

887|gene|hla        GRYEEYEVEAELSGAELVGWAYDHPLADHVAEYP-NFEGAGQVYAADYVEADRTGLVHSA
2671|gene|hwa       GRYDDYTVVEEYSGDELTGWEYDHPLADQVQTYA-DFAGAGEVYTAEYVEADRTGLVHSA
16810|gene|hbo      GRYEDYEVVEELSGEEMVGWEYDNPLAGHLNEYA-DFEGAGEVYTAEYVEADRTGLVHSA
2190|gene|nrc1      GGYSDHEIVADHSGSDLIGWSYTPPLADAVPANPTDADGTHEVYHGDWVEADRTGLVHSA
610|gene|nph        GGYEDYEVVGEHEGSDLVGWRYEHPLREEVPEAP-AFEGALEVYGADYVEADRTGLVHSA
1825|gene|hut       GRYDDYEIVDEATGEEMVGWEYEHPLREEVPDAP-EGKDALQVYTADYVEADRTGLVHSA
12634|gene|hma      GRYDDYEVVEELSGEEMVGWAYEHPLAEEVPDHA-QGEGSGQVYTADYVEADRTGLVHSA
3050|gene|hhi       GRYDDYEVVEELSGEEMVGWAYEHPLAEEVPDHA-QGEGSGQVYTADYVEADRTGLVHSA
                    * *.:: :  :  * :: ** *  **   :   .    .: :** .::************

887|gene|hla        PGHGEEDFHRGSELGLDIYCPVGPNGEFTEAAGEYAGEFVRDANDDIVDDLVADGHMLAH
2671|gene|hwa       PGHGQEDFARGQELDLETFVPVDGRGEFTEAAGQYTGTFVRDANDEIINDLDEEGVLLSS
16810|gene|hbo      PGHGQEDFARGQDLGLDVFVPVDGRGEFTEQAGDYAGTFVRDANPDIIEDLEADGSLLHS
2190|gene|nrc1      PGHGEEDFERGAELDLPVFCPVGEDGVYTDAGGKYAGAFVRDANDDIIADLEARDAMLAS
610|gene|nph        PGHGEVDFERGQELGLSVFCPVGPDGVYEDAAGDYAGQFVKDADAAIMDDLEAKGLLLSR
1825|gene|hut       PGHGEEDFERGQELGLDVFCPVGGDGVYDDTAGKYAGEFVKDADAAIMDDLDANGNLLSR
12634|gene|hma      PGHGEEDFERGQELDLEIFCPVGSDGVYTDDAGKYAGTFVRDANDEVIDDLDENGVLLSS
3050|gene|hhi       PGHGEEDFERGQELDLEIFCPVGSDGVYTDDAGKYAGTFVRDANDEVIDDLDENGVLLSS
                    ****: ** ** :*.*  : **.  * : : .*.*:* **.**:  :: **   . :*  

887|gene|hla        GT-VNHSYGHCWRCDTGIIQLVTDQWFISITDVKEDLLDNMEQSEWHPQWARDNRFRDFI
2671|gene|hwa       GT-HEHRYGHCWRCDTDIIFLATDQWFITVTDIKDELLDNINDSEWYPQWARDNRFRDFV
16810|gene|hbo      GE-HSHRYGHCWRCDTDIIFLATDQWFITVTDVKDELLDNIEDSEWHPQWARDNRFRDFV
2190|gene|nrc1      QT-VEHSYGHCWRCDTGIIQIVTDQWFITITDVKDELLANMDTSEWHPEWARDNRFRDFV
610|gene|nph        GT-VNHDYGHCWRCDTPIIQMVTDQWFITVTDIKDELLANMEESEWFPQEARDNRFRSFI
1825|gene|hut       DT-THHSYGHCWRCDTGIIQIVTDQWFITVTDIKDEMLDNIADSEWHPDWARDNRFQDFV
12634|gene|hma      EPGHTVREGQCWRCDTDIVRIVTDQWFITVTDIKDELLANIEDSEWYPQWARDNRFRDFV
3050|gene|hhi       ESGHTVREGQCWRCDTDIVRIVTDQWFITVTDIKDELLANIEDSEWYPQWARDNRFRDFV
                            *:****** *: :.******::**:*:::* *:  ***.*: ******..*:

887|gene|hla        EDAPDWNVSRQRYWGIPIPIWVPED-AEAGNL--DDDMIVIGTREELGERVEEDIDPKTI
2671|gene|hwa       ADAPDWNVSRQRYWGIPLPIWESVDDADTGDNSTSDDWIVIGTREELAERADQDVNPAEI
16810|gene|hbo      ADAPDWNISRQRYWGIPLPIWESED---------GEDFIVVGTREELAERADQDVDPGEL
2190|gene|nrc1      ENAPDWNVSRQRYWGIPVPIWTPED--WSGD---AEDVLVVGTREELAALADQDVDPASV
610|gene|nph        EESPDWNVSRQRYWGIPIPIWTPDD--WSGD---VEEAIVVSTREELAERVDQDIDPESV
1825|gene|hut       EEAPDWNVSRQRYWGIPIPIWTAED--WDGS---MDDAIVIGDREELAERVDQDIEPDAV
12634|gene|hma      EDAPDWNVSRQRYWGIPIPIWLPED--WSGD---MDDAIVVGDREELAERVDQDIDPENV
3050|gene|hhi       EDAPDWNVSRQRYWGIPIPIWLPED--WSGD---MDDAIVVGDREELAERVDQDIDPENV
                     ::****:*********:*** . *          :: :*:. ****.  .::*::*  :

887|gene|hla        DLHRPAVDDLTVVEDGTTYRRVEDVFDVWLDSSVASWGTLGYPSDETAHDELWPADFIVE
2671|gene|hwa       DLHRPAVDPLTITENGSRYERVPDVFDVWIDSSVASWGTIDYPGETDAYDELWPADFIVE
16810|gene|hbo      DLHRPSVDPLTITEDGTTYERVPDVFDVWIDSSVATWGTLDYPGNETDFEELWPADLIVE
2190|gene|nrc1      DLHKPTVDDITITEDGTEYTRVPDVFDVWLDSSVASWGTLNYPEQEDDFDELWPADLIME
610|gene|nph        DLHKDTVDDLTITADGTTYTRVPDVFDVWLDSSVASWGTLGYPGNEDDFEELWPADLIME
1825|gene|hut       DLHKGTVDDLTITEDGRTYERVPDVFDVWLDSSVASWGTLDYPEQTEDFEELWPADLIME
12634|gene|hma      DLHKGTVDDLTITEDSTTYTRVGDVFDVWLDSSVATWGTVNYPEQTEDFEELWPADLIME
3050|gene|hhi       DLHKGTVDDLTITEDGTTYTRVGDVFDVWLDSSVATWGTVDYPEQTEDFEELWPADLIME
                    ***. :** :*:. :.  * ** ******:*****:***:.** :   .:******:*:*

887|gene|hla        AHDQTRGWFWSQLGMGTAAVGEIPYEEVLMHGFANDENGRKMSKSVGNIVTPEEAIERAG
2671|gene|hwa       AHDQTRGWFWSQLGMGTAATGQVPYEEVMMHGFANDENGRKMSKSRGNIVTPEEAIDRAG
16810|gene|hbo      AHDQTRGWFWSQLGMGTAARGEIPYEEVLMHGFANDENGRKMSKSLGNIVTPEEAIDRAG
2190|gene|nrc1      AHDQTRGWFWSQLGMGTAALGDVPYEEVLMHGYANMPDGRGMSKSKGITIEPNEVIDEYG
610|gene|nph        AHDQTRGWFWSQLGMGSAALGEAPYETVLMHGWALAEDGRKMSKSIGNIVAPQEAIDRHG
1825|gene|hut       AHDQTRGWFWSQLGMGTAAVGEIPYDEVLMHGYAMMPDGRGMSKSKGITVEPQEAIAEGG
12634|gene|hma      AHDQTRGWFWSQLGMSTAATGEIPYKQVLMHGYANMPDGRGMSKSKGVLIDPHEVIEKHG
3050|gene|hhi       AHDQTRGWFWSQLGMSTAATGEIPYKQVLMHGYANMPDGRGMSKSKGVLIDPHEVIEKHG
                    ***************.:** *: **. *:***:*   :** **** *  : * *.*   *

887|gene|hla        RDPLRTYLLSHDQQGVDLAFEWDGLGELQGKLNILWNVFRFPLEYMDLDGYDPAEAD---
2671|gene|hwa       RDPLRAYLLSHDQQGVDLSFEWDGLGEMQSTLNIFWNVFRFPLPYMDLDGYDPATAD---
16810|gene|hbo      RDPLRAYLLSHDQQGVDLSFDWDGLADTQSALNIFWNVFRFPLPYMELDGYDPANPD---
2190|gene|nrc1      ADPMRMFLLSVTPQGDDMSFSWDETENMQRDLNILWNVFRFPRPYMALDDFDANVPAAFG
610|gene|nph        ADPMRLFLLTQNPQGDDMRFSWDEMENRQRDLNILWNVFRFPLPYMRLDDFDPDAVA---
1825|gene|hut       ADPMRAFLLSQNPQGEDMRFSWDGMDSMQRNLNILWNVFRFPLPYMRMDDFSPDETT---
12634|gene|hma      RDPMRLFLLSVTAQGEDMNFSWEETAEMQRRLNILWNVARFPLPYMRADDFDPEETT---
3050|gene|hhi       RDPMRLFLLSVTAQGEDMNFSWEETAEMQRRLNILWNVARFPLPYMRADDFNPEETT---
                     **:* :**:   ** *: *.*:   . *  ***:*** ***  **  *.:..       

887|gene|hla        -------LDD--GELELVDEWVLSRLQSVETEVTEAWADYRVSDAVNAVIEFVTQDVSRF
2671|gene|hwa       -------LSE--GSMNIVDEWVLSRLQSVKATTRAAWEEYEIDTAVNTILEFITDDVSRF
16810|gene|hbo      -------LSA--GELSVVDEWVLSRLQTVKADVADAWDDYEVHDALNAILDFVTEDVSRF
2190|gene|nrc1      GDDAGVGIAD--ADLETVDEWLLSRLQHVKADATAHWEDFEQHRALDAVLEFVVEDLSRY
610|gene|nph        -------LDE--AALETVDEWVLSRLSTVTAEMTDHWENFRQDKALDELLAFIVEDVSRF
1825|gene|hut       -------VED--VELEQIDEWVLSRLQTVESEMGEHFEDRRQDRAIQGLMDFVVEDVSRF
12634|gene|hma      -------VEDLRDDLELVDEWVLSRLQSVTEAMTDSMDDFENDKAVDELLEFVVEDVSRF
3050|gene|hhi       -------VEDVREDLELVDEWVLSRLQTVTEAMTDSMDDFENDKAVDELLEFVVEDVSRF
                           :      :. :***:****. *         :     *:: :: *:.:*:**:

887|gene|hla        YVKAVRDRMWEEADSASKRGAYATLATALDETTRLLAPIAPYMTERMYQTLDGEA--TTV
2671|gene|hwa       YIKAIRERMWADEDSASKRGAYATLSTVLDETIRLLAPIAPYLTEQMYQHLNGSE--TTV
16810|gene|hbo      YVKAIRERMWEEEDSESKRGAYATLATVLNETVQLIAPFTPYVAERMYQHLDGSE--TTV
2190|gene|nrc1      YVQVVRERMWEDDASASKTAAYATMQRVLLEVVALLAPYAPFVTEELYSHLTGDRGYDTV
610|gene|nph        YIQVVRERMWEEETSESKLAAYATLHHVLVETTKLLAPYAPFVAEEIYGTLTGDGGHETV
1825|gene|hut       YVQAVRDRVWAEGEDGSKTAAYATLYRVLEETVALLAPFTPFIADEIYQYLTGDAGYDTV
12634|gene|hma      YIQVVRERMWEEEDSASKQAAYATLYRVLESVAALFAPFTPFVAEQVYGALTGDAGHPTV
3050|gene|hhi       YIQVVRERMWEEEDSASKQAAYATLYRVLESVAALFAPFTPFVAEQVYGALTGDSGHPTV
                    *::.:*:*:* :  . ** .****:  .* ..  *:** :*:::: :*  * *.    **

887|gene|hla        HQLDYPEPDEDLHDPELERDVAVLRDVEEAAANARQQAGRKLRWPVPRVVVESDDENVIA
2671|gene|hwa       HALSYPSVDPEWQNETLESEMAVLRDVEEAAANARQQGGRKLRWPVPRVIVEAEDDSIAD
16810|gene|hbo      HALDYPTVDEAWRDEELERNMAVLRNVEEAAANARQQGERKLRWPVQRVVVASEDDEVAE
2190|gene|nrc1      HMADWPTVEESLRAPALEADVAVLRAAEEAGSHARQQAGRKLRWPVTRVVVDAAEDSVVD
610|gene|nph        HMADWPDPDERFRDPQLETDVDIVAAVEEAGSNARQQAERKLRWPVTRVVVAADDDRAAE
1825|gene|hut       HMCDWPEPDDTLRDVSLENEISVVRAVEEAGSNARQQAERKLRWPVKRVVVDVDDQEVGG
12634|gene|hma      HMCDWPEVDADLHDPALEREIEVVREVEEAGSNARQQAERKLRWPVTRVVVDVDSDDVAD
3050|gene|hhi       HMCDWPEVDADLHDPALEREIEVVREVEEAGSNARQQAERKLRWPVTRVVVDVDSDDVAD
                    *  .:*  :   .   ** :: ::  .***.::****. ******* **:*   .:    

887|gene|hla        AVERLSDLIADRVNAREVTVT---DAFDELVETAEPQMGAIGPAFGADAQKVMNAVQGA-
2671|gene|hwa       AVESLSGLLADRVNTEAIETV---TQFDELIERAQPEMSVIGPEFGADAQRVMDAIEGG-
16810|gene|hbo      AVEALSDLLADRVNTRTIEVV---ETFDELVEYADPQMGVIGPAFGGDAQKVMQAVKGV-
2190|gene|nrc1      ALDAHGDLLADRLNTRAIEVVEPGAAWDELAYSARADMSELGPAFGDDAGAVMNALNDAR
610|gene|nph        AVDRHRDLLRDRLNAREIELVEPGSDWEELSYTARADMSVLGPTFGDEAGEVMNAINAVS
1825|gene|hut       SIELQAELLADRLNAREIEVVAPDEAWGELTYSAEADMSKLGPAFGDEAGAIMNALNDAS
12634|gene|hma      AVRAQEAIIADRLNARAVEVVGADDEWGELQYSAEADMSELGPAFGDDAGRVMNALNEAR
3050|gene|hhi       AVRAQEAIIADRLNARAVEVVGADDEWGELQYSAEADMSELGPAFGDDAGRVMNALNEAR
                    ::     :: **:*:  :  .     : **   * .:*. :** ** :*  :*:*::   

887|gene|hla        ----TRAAVEGGEVTVDG-DPVDLADEMVEYVAEPPEHVSGADF------DGGAVYVDTS
2671|gene|hwa       ----SREILTEGV-TIDG-VQYEITDEMITFDAEPPAYISAADF------DGGTVYVDTS
16810|gene|hbo      ----PREEVESGV-EVDG-ETVELTDEMVEYRAEPPENVYDAEFAATDGTDGGVVYVDTS
2190|gene|nrc1      VTDRDIDALAEQVAADLGRDDIELTTEMVEFVEETPEHVAGAAFETETA--AGTVYVDTE
610|gene|nph        VTDTAVEALEAAVETELG-RDIELTDEMVSFNTETPEGVEGTAF-TVDGDDRGVVYVDTA
1825|gene|hut       VAKPSIEALESAVASELG-RGVDLTAEMVEFVRNTPDGVASTEFEALDG--GGVVYVDTT
12634|gene|hma      VTEQSLDTLEGTVREALG-EDVDLTEEMVEFRRETPEGVTGTEFTALDG--GGVVYVDTA
3050|gene|hhi       VAEQSLDTLEGTVREALG-EDVDLTEEMVAFRRETPEGVTGTEFAALDG--GGVVYVDTT
                            :        *    ::: **: :  :.*  :  : *        *.***** 

887|gene|hla        LTPEIESEGYARDVIRRIQEMRKELDLDVEARIRVGVTVDDDRVADFVDEHADLIAGEVR
2671|gene|hwa       LTESIEAEGYARDVIRRIQQMRKELALDVDTEIQTAVDVADDRVADLVAQQRDVVATETR
16810|gene|hbo      LTEEIEAEGYARDVIRRIQEMRKRLSLDVEEEIAVSLDVQDDRVADLVYRHEDLIAEEVR
2190|gene|nrc1      LNEDVESEGYAREVVRRVQEMRKEMDLAMDAEIRLDVLVFDERVGELVARHEPLITAETR
610|gene|nph        LTEDIESEGYAREVIRRVQEMRKDLDLDIEAEIRVDLDIADERVATLVDEHEGLIADEVR
1825|gene|hut       LTEDIESEGYAREVVRRVQEMRKDLDLAMDARITVEYDIADDRVAELVEEREDLIAEEVR
12634|gene|hma      LTEDIESEGYAREVIRRIQEMRKDLELDIEERIAVDLTIDDERVDSLVREHEALIKEEVR
3050|gene|hhi       LTEDIESEGYAREVIRRVQEMRKDLELDIEERIVVDLAIDDERVDSLVREHEALIKEEVR
                    *. .:*:*****:*:**:*:*** : * ::  *     : *:**  :*  .  ::  *.*

887|gene|hla        ADAWIDDPSDAADAEGGLVEEWEVEGVAVTIGIEPVA-------------
2671|gene|hwa       TNAFVDNIDRASENGQALIEEWDVEGVTVTIGVAPLKAQLSDQS------
16810|gene|hbo      ATTL-----NSDGEDADLTEEWDIEGVTVVISIAQTA-------------
2190|gene|nrc1      AREL-------GEVEDGHREEWDVEGTTMILEVEAV--------------
610|gene|nph        AAEF-------ADLNAGHERVWDVESTDITITIDPVSER-----------
1825|gene|hut       ADAF-------GSVGDGHRKTWEIEGVAAEIAVEEV--------------
12634|gene|hma      ADEL-------DGVEDGHRKTWEVEGTDMEIAIAPCEADQREASEQASGD
3050|gene|hhi       ADEL-------GGVEDGHRKTWDVEGIEMEIAIAPVAAAEASD-------
                    :                    *::*.    : :