HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0288COG1824arCOG00624Permease similar to cation transportershypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0288 nrc1 VNG2458 vng2458 no entry
cHOG0288 hmu HMUK1257 Hmuk_1257 MgtE integral membrane region
cHOG0288 hma RRNAC3134 hypothetical protein
cHOG0288 hwa HQ3417A divalent cation transporter, subunit I, MgtE family protein
cHOG0288 hla HLAC2739 Hlac_2739 MgtE integral membrane region
cHOG0288 hbo HBOR00990 Hbor_00990 cation transporter
cHOG0288 hut HUTA2085 Huta_2085 MgtE integral membrane region
cHOG0288 hvo HVO_0124 HVO_0124 Divalent cation transporter domain protein
cHOG0288 nph NP0224A tp48_1 transport system 48 ( substrate zinc), subunit 1
cHOG0288 hhi 401 mgtE2 MgtE integral membrane region
MUSCLE (3.6) multiple sequence alignment


224|gene|nph       --------MDARHGAWRIYRESIAILVVSLGGGIFAGSVLGTEGMTDGFEQFPGLLLLLP
2739|gene|hla      --------MPGHDTARDVYRQALPVILVSLVAGLFSGTILGSETMRAGISEVPGLLLLLP
13134|hp|hma       --------MTVREVALEAYREALPVLALSAVGGLFAGVVLG--GMDAELQDVAGLLVLVP
401|gene|hhi       --------MTVREVALEAYRESLPVLALSAVGGLFAGVVLG--GMDAELQDVAGLLVLVP
2085|gene|hut      --------MTIREVAVRAYREGLPALSASLVGGLLAGVVLG--GMRAELTAIDGLLVLVP
2458|chp|nrc1      --------MSVRRVAATAYREAAPALAASVLGGLFAGAVLG--GMRAQLEAVDGLLVVVP
3417|gene|hwa      MLDIIATDVTVRDAAREAYREAIPALLASLIGGLLAGVVLG--GMRSELRAVPGLLVLVP
990|gene|hbo       --------MTIRDAATEAYREALPALVASLVGGLIAGIVLG--GMRAELRDVPGLIVLVP
                           :  .  *   **:. . :  *  .*:::* :**   *   :  . **::::*

224|gene|nph       AFLGTRGNVYGALGARISSGLHQGLIEPRFEW-DRRLINAVTASFINGIGISVFIGFLSW
2739|gene|hla      AFLATRGGVYGSLGARLSTGLHQGLIEPRFRL-DRRLTNAILASFINGMTVSVFIAVITF
13134|hp|hma       ALLATRGNVYGSLGARLGSALHQGLINPRFSFDDDRINAAVAAALANGVLISGVAAVMAV
401|gene|hhi       ALLATRGNVYGSLGARLGSALHQGLIDPRFSFDDDRINAAVAAALANGVLISGVAAVMAV
2085|gene|hut      ALLATRGNVYGSLGARIATALHQGFLEPRLGDADDRLLRAVAAAIGNGLLASAFAAVVAT
2458|chp|nrc1      ALLATRGNVYASFGARLATGLHQGIIEPHVAAGDRRLRAAVGAAMGNGLLASGFAAAVAF
3417|gene|hwa      ALLATRGNVYGSLGARISTGLHQGLIEPRLRGVDTRLTAAATAALMNGLAASVFAAIAVF
990|gene|hbo       ALLATRGNVYGSLGARIATALHQGLIEPRVTAGDRRLRAAAAAALGNGLLASAFAAVAVF
                   *:*.***.**.::***:.:.****:::*..   * *:  *  *:: **:  * . .    

224|gene|nph       VVIGFLRPESEASLLALVSIMLIAGVLTSVVLIVGLLALVFAGYKYGMDPDNLVGPVVTT
2739|gene|hla      LWLRLFGN-A-GNLLELVGIMVVSGFLSAVLMISVLIAVIFVGYRRGLDPDNVIGPVVTT
13134|hp|hma       ALLALVGRPS-APLTTLVAIALIAGFVSGLLLTIAVVSVVFVGYRRGLNPDTLAGPVVTT
401|gene|hhi       ALLALVGRPS-APLTTLVAIALIAGFVSGLLLTIAVVSVVFVGYRHGLNPDTLAGPVVTT
2085|gene|hut      AALAWLARPA-AGLPVLLTVAVISGLLSGIALATTVVVVVFAGFRRGYNPDTLVGPLVTT
2458|chp|nrc1      GVLTALGRPV-AGLATLVGVALVAGLLSGVALTGAVVAVVFAGYRRGYNPDTLVGPLVTT
3417|gene|hwa      LILTILETSV-ASVLILIAIALLAGLLSGGVLIITVITAVIIGYRRGYNPDALVGPLVTT
990|gene|hbo       LVLSALGNRV-APLPVLVGIAVLAGLLSGAVLIAVVVTVVFAGYRRGRNPDTLVGPIVTT
                     :  .     . :  *: : :::*.::.  :   ::  :: *:. * :** : **:***

224|gene|nph       LGDIFGVVFLYTAVLVV---GVLI
2739|gene|hla      LGDVFGVFFLLVGIYVV---GTVV
13134|hp|hma       TGDVVGIATLLGATRLVLALGGG-
401|gene|hhi       TGDVVGIATLLGATRLVLALGGG-
2085|gene|hut      AGDVFGMAALLIAARLV--IWGVG
2458|chp|nrc1      TGDLFGLAFLVLAVRLI--VGGV-
3417|gene|hwa      TGDVFGMLFLLAAVRLVSAVGGVS
990|gene|hbo       TGDVFGILFLLVAVRTVLAIGGVL
                    **:.*:  *  .   :