HOG Organism Gene ID Name Annotation
aHOG2870 hbo HBOR23210 Hbor_23210 hypothetical protein
aHOG2870 hwa HQ1612 cox cluster protein
MUSCLE (3.6) multiple sequence alignment


23210|hp|hbo       MSERTE------------------------DIDDH-----------------------TQ
1612|gene|hwa      MSESDDQETTSEHNSSHESETSEKPETGSSEMVDHQNQTQNPTQDQMDAKKQSQHAEQSR
                   ***  :                        :: **                       :.

23210|hp|hbo       SGGLRGPRLVAILYVALVAVAGLAGVLVAVFVDGLRPPQFLFLVPFPPTPLGFGAYGALT
1612|gene|hwa      TQGRSGRQFVIILYIALTGAAGAAGYLTGYFVDGLSAPMFLFIIPFPLSPLGFAAYGGLT
                   : *  * .:* ***:**...** ** *.. ***** .* ***::*** :****.***.**

23210|hp|hbo       IALVLGIPLALVIYVSQNIDEKAT
1612|gene|hwa      IAIVIGIPLGLVIYVSEYAESIET
                   **:*:****.******:  :.  *