HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0287COG1836arCOG02245/2Predicted membrane proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0287 nrc1 VNG1782 vng1782 no entry
cHOG0287 hmu HMUK1546 Hmuk_1546 protein of unknown function DUF92 transmembrane
cHOG0287 hma RRNAC1718 hypothetical protein
cHOG0287 hwa HQ3330A hypothetical protein
cHOG0287 hla HLAC2185 Hlac_2185 protein of unknown function DUF92 transmembrane
cHOG0287 hbo HBOR07330 Hbor_07330 predicted membrane protein, COG1836
cHOG0287 hut HUTA0192 Huta_0192 protein of unknown function DUF92 transmembrane
cHOG0287 hvo HVO_2319 HVO_2319 integral membrane protein
cHOG0287 nph NP4542A hypothetical protein
cHOG0287 hhi 2252 HAH_2252 hypothetical protein
cHOG0287 hhi 339 HAH_0339 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


339|hp|hhi         ------------------------------------------------------------
1782|chp|nrc1      ------------------------------------------------------------
2185|gene|hla      --------------------MAAVAVLAPALGDAAAVPFLAAAGLAFFG----------V
4542|hp|nph        -------MTRDLRRAVAYLLVGSLVFLAPALDAHYGSSTAAAATAAVFGLVAVAGFK--T
3330|hp|hwa        MSPIAAYVQPTLRRAGGFALIGTLAVTAPVLGQAAFAPFAAVGIMAAFL----------I
7330|hp|hbo        -------MQSTLRRAGGFAVVGTLALAAPVLKAATFAPFVAIALLAAFV----------V
192|hp|hut         -------MTSALRRAVAFALVGFASVIAPVADRLFAPDIATLVAAVPFLLLT--GGLHVV
11718|hp|hma       ------------------------------------------------------------
2252|hp|hhi        -------MTGTVRRAGAFAAVGTLAVAVPAATGFRSLELATVAAIAPFVLVAALGVTVIG
                                                                               

339|hp|hhi         ------------------------------------------------------------
1782|chp|nrc1      ----------------------MCGFVVAAAGAAF-------------------------
2185|gene|hla      RDGRWFETLALRGDREEERLYGFVAFALAAAGLALFASLPRAPLPYEAFAAATLAVGGGR
4542|hp|nph        SDGPLFELFARRRDRAEERLYGLASFALAVAALGVLLV--AVELPAVVPVVAVFVLTVGN
3330|hp|hwa        TDGPIFELFARPGDRQDGRLNGLAGFALAAAGLAILST--ELGLPVELFVASVLILAYGN
7330|hp|hbo        TDGPLFEVFARPGDHQDGRLNGLAGFALAAAGLAILVV--AVDMPVSLFVAAVLVLSYGN
192|hp|hut         ESGVIFELFARPGDRRDGRLYGLAGFSLSIAALILLAI--QFDMPTAVPVAATLILSVGN
11718|hp|hma       -----------------------------------------------MFVGVVVIVAYGN
2252|hp|hhi        QDSRLFDLFARPGDYEDGKLYGLAAFSLAAAGLALLAV--RFSLPVPVFVGVVVIVAYGN
                                                                               

339|hp|hhi         ---------------------------------------------------------MAA
1782|chp|nrc1      AGQAVVAASA----------------GAPVGQ-------------------PQFVFLAVS
2185|gene|hla      LGRTVVAGRATDEFPLVAGYVAGGTLGALAGQVGVL---LQTDRAGLVDGLPELVFLAAV
4542|hp|nph        VGQRLAAGYVASPAVGASAFAAFGTVGGSVAAVAA----GWLGAAVAS--LPLVVFVAAS
3330|hp|hwa        LGKRLIAETSDEPFVGTAGFVITGTLAGIAGQFTT----ATIIESQVV--IPRYVFLATA
7330|hp|hbo        LGKQCVAAVSDDPFLGTSGFVVGGFLGGVLGQVGV----ATATTLPTA--YPLFVFLASA
192|hp|hut         VGAHVVRAQGGEPIVATAGFVVAGFLAGFGSFVLS----GSISGGRPA--FPVLVFLAAS
11718|hp|hma       LGQRLAYTVRSDEVVATAGFVLVGFVAGVAGQVLGTRIQAAVGEGAAVVDLPLVLFLAAS
2252|hp|hhi        LGQRLAYTVRSDEVVATAGFVLVGFVAGVAGQVAGTRIQAAVGEGAAAVDIPLVLFLAAS
                                                                               

339|hp|hhi         GVLCTAVFLPVMY------------VLLHAYVVLTVSVGP--------------VDTLNG
1782|chp|nrc1      GALLAGIMRTLFALRDAPLVLGSVVVVLWVVTALAPLAGVPTVAAWERVLVALAVTTAFG
2185|gene|hla      AALTAALVRSLVFDRDAHITVILVAFAVWGFVALDPAVTA------SLVAFGLAVTGALG
4542|hp|nph        GALLGGLIRSVLYVQDDSLVVLAVALLVWLLLSLGLSPTP------ERVAVGLAVTVGLG
3330|hp|hwa        GALVAALLREMLFERDDPLVMLASGLLLWLFAYLGSGVEA------IELSVALAVTAALG
7330|hp|hbo        GAIVAALFREMLFERDDPLVMLSTGLLLWSFDALSGAIGT------VEIAAALALTVAFG
192|hp|hut         GALLAALLRSMLFERDDPLVIISVGLLLWLFTDLSISLST------SGIAIALAITVALG
11718|hp|hma       GAFVAALLRSVLFERDDPLVMLTVGLLLWLFFELDPSVTA------RRVVIALAVTVLLG
2252|hp|hhi        GAFVAALLRSVLFERDDPLVMLTVGLLLWLFFELDPSVTA------QRVVIALAVTVLLG
                   ..:  .:.  :.             . :.    *                    :    *

339|hp|hhi         LIDFALVAGGLTTFVAGFVSQLLTETF-----------------LAKR------------
1782|chp|nrc1      WVSRALGATSIAGMLTGVFLGLLAVVLGGYGWFVVLVAFFAVGSLATKFKYELKADRGVA
2185|gene|hla      YVSFALGTASVPGMLTGVLSALLAVVLGGVGWFATLMSFYAIGGLASKYRFDEKADRGVA
4542|hp|nph        YIAYALDTASVTGMLTGVLLALFAVVLGGYGWFVLLVTFFGLGGLASKYRYDEKLDRGIA
3330|hp|hwa        FISYALGTASVAGMLSGVLLSLLVIVLGGFGWFAVVISFFSLGALSTKYRYDEKKQRGIA
7330|hp|hbo        LVSYVLKAASVSGMLSGVLLSLLVTVFGGFGWFAVLMSFFAIGALSTKFRYDEKLDRGVA
192|hp|hut         YVSYALETASLPGMLTGVLLSLLTIVIGDYGWFAMLITFFGGGGLASKFRYDEKVIRGIA
11718|hp|hma       YLSYALDTASLPGMLTGVLLSFLTIVLGGFGWFAMLITFFGLGGLSTKYRYDEKLDRGIA
2252|hp|hhi        YLSYALDTASLPGMLTGVLLSFLTIVLGGFGWFAMLISFFALGGLSTKFRYEEKLDRGIA
                    :  .* : .:. :::*..  ::. .:                 *:..            

339|hp|hhi         ------------------------------------------------------------
1782|chp|nrc1      EPNDGARGTANVLGNSAAALIALVLYAAH-AHVPFADTAFLFAYAGSVATALADTLSSEV
2185|gene|hla      QENEGARGTGNVLANSAVALVAVVGYAAT-AHVGVPGALFGFAFAGATATAMADTLSSEI
4542|hp|nph        QENEGARGGGNVLANSAVALVAVVGYAAS-GHVGIDATVFKFAFAGAVAAALADTFSSEF
3330|hp|hwa        EENEGARGTGNVLGNAAVALICVICFAAS-ESIPIDPVLFQYAFAGSIAAALSDTLSSEL
7330|hp|hbo        EDNDGARGTRNVFGNAAVALASVIGFAAS-AHTAVDGMLFQYAFAGSMAAALSDTLSSEI
192|hp|hut         QENDGARGSGNVLANSLIALFAVLAAAASPRLTGVHPDLFLFVFAGSVAAAMSDTLSSEF
11718|hp|hma       EENEGARGSGNVLANSIVALFAVVAAAASPSHIAVDPLLFFYAFAGAVAAAMTDTFSSEF
2252|hp|hhi        EENEGARGSGNVLANSIVALFAVVAAAASPSHIAVDPLLFFYAFAGAVAAAMTDTFSSEF
                                                                               

339|hp|hhi         ------PA----------------------------------------------------
1782|chp|nrc1      GGLFDTPRLVTTFERVDPGTDGAVTWQGELAGVVGATIIAVLSVAVFGV--TLRGGGVVV
2185|gene|hla      GGLYDGPRLVTTLSRVEPGTDGAVTWQGELAGLAGALLVAGLAAFGMPIGDAIAGGGIVV
4542|hp|nph        GGLFDAPRLITTLERVDPGTDGGVTWQGAVAGATGSGIIAGLGWAFFEF--DTIATATVL
3330|hp|hwa        GGLYDNPRLITTFTPVPPGTDGGVTWQGEIFGILGGLIIGIVAFALFPSV-DATGSIAIG
7330|hp|hbo        GGLYDNPRLITTLERVDPGTDGGVTWQGELAGLVGSAIVAAIAAFLLSGVTGLLGGAVVL
192|hp|hut         GGLYDAPRLITTFERVEPGTDGGVTWQGELAGIAGAGIIAAIALLLFETI-TLGGAGVIV
11718|hp|hma       GGLYDNPRLITTLRPVEPGTDGGVTWQGVAAGAAGAGIIAGIAALTQDI--STVGSGVIL
2252|hp|hhi        GGLYDNPRLITTLKPVEPGTDGGVTWQGVAAGAIGAGIIAGIAALTQDI--STVGSGVIL
                         *                                                     

339|hp|hhi         ---------------------------------------------------
1782|chp|nrc1      AAGVAGMTADSLAGATIEGRVLTNQGVNFLATLTGAAVGGALALAVGVA--
2185|gene|hla      LAGVAGMTVDSLLGALIEGERIGNQAVNFLATLSGAIVGVAAAVALGVGL-
4542|hp|nph        GAGVLGMVVDSILGATLEGGRLGNQSVNLLATLSAGTAAAVVAVLI-----
3330|hp|hwa        IAGFLGMTADSILGATIEGDKVGNETVNLAATFIGAILSVGSAITLL----
7330|hp|hbo        LGGLAGMTVDSFLGATVEGARIGNEAVNFSATLVGAAISTGAAFVLF----
192|hp|hut         ASGFIGMTTDSLLGATIEGRWVGNQGVNFLATLSAGIAGAVLAVATNIVAL
11718|hp|hma       LCGLVGMTVDSLLGATVEGSVVGNQGVNMLATLAAALTGAGVVLTAGLL--
2252|hp|hhi        LCGLVGMTVDSLLGATVEGSVVGNQGVNMLATLAAALTGAGVVLTAGLL--