HOG Organism Gene ID Name Annotation
aHOG2865 hbo HBOR21560 Hbor_21560 superfamily II helicase( EC:3.6.1.- )
aHOG2865 hwa HQ1631 mer3 ATP-dependent DNA helicase
MUSCLE (3.6) multiple sequence alignment


21560|gene|hbo      -----------------------MHVRDLPLPGRILEHYESQGIETLYPPQVAAVEAGVT
1631|gene|hwa       MDFDKVRNTPRTFVHVVLNDSVSLDINELPVSAAVREHYYDAGITQLYPPQEAAVKAGVV
                                           : :.:**:.. : *** . **  ***** ***:***.

21560|gene|hbo      EGERLVAAIPTASGKTFIAELAMLTAEGPALYIVPLRALAREKYETFAELPGVSVGISTG
1631|gene|hwa       DGENVIVAIPTAAGKTLIAQLAMLTADGPALYIVPLRALAREKYETFTALPGIDAAISTG
                    :**.::.*****:***:**:******:********************: ***:...****

21560|gene|hbo      DFDSTDEDLADNDIVVATAEKVDSAIRTGAPWIESLACVVVDEVHLLGSDGRGPTLEVTL
1631|gene|hwa       DFDAAENDLETADVVVATAEKVDSAIRNGASWVDKLACVVVDEVHLLGSANRGPTLEITL
                    ***::::**   *:*************.**.*::.************** .******:**

21560|gene|hbo      ATLQRRAPGLQIVALSATVDNPEDIADWLDADLVETTWRPVSLRTGVY--ADGSVTFDDD
1631|gene|hwa       ATIQRRASGVQVVALSATIDNPEEVASWLDAELVSSTWRPVSLRTGVYDASDETVIFDDG
                    **:****.*:*:******:****::*.****:**.:************  :* :* ***.

21560|gene|hbo      SALGIDVEPTGPDD-------------DDATEATAALIADAVADGGQCLAFVRSRREAES
1631|gene|hwa       NRLPITADSDSPPETATDLTESDDTSTDADTKATISLVADAVISGGQCLAFVRSRQEAAS
                    . * * .:. .* :             *  *:** :*:**** .***********.** *

21560|gene|hbo      LATRLADESLADDSLAGASPNDCAELADEVSEIGATETGSRLADVVESGVAFHHAGVRSG
1631|gene|hwa       LAKQLADVGF------GANP----ELAEDIRDIGTTPTGKQLADAVTAGVAFHHAGLRSD
                    **..*** .:      **.*    ***::: :**:* **..***.* :********:**.

21560|gene|hbo      HRALVESAFREKRLKVICATPTLAAGVNVPARRVVIRDLKRYTGEKMTWLPVLEVHQMCG
1631|gene|hwa       HRILIESAFRNRDLRVICATPTLAAGVNVPARRVVVRDLKRYTGEKMAWLPVLEVHQMCG
                    ** *:*****:. *.********************:***********:************

21560|gene|hbo      RAGRPHLDPYGEAILVN---------------DGDESD--TEELWERYVTAEAEAVESKL
1631|gene|hwa       RAGRPHLDPYGEAVLIGDITNKIDSSDAQTSADGEQKSIRTESRWRRYVDAGPESIESQL
                    *************:*:.               **::..  **. * *** * .*::**:*

21560|gene|hbo      AARDALRTHVLSVVASGFADSRDGVVDLLDATFFAHQSPDVNRARLVDSVVEELAEMEML
1631|gene|hwa       TARNALRTHVLALIVAGFADSKNQVLDVLDSTFFAHQSSTADLTAVIDDVVAELIEMGLL
                    :**:*******:::.:*****.: *:*:**:*******. .: : ::*.** ** ** :*

21560|gene|hbo      DDGDGNGRKDRLTATELGSAVSRQYVTPVTGARLVEGVQTAARMADENVTELTALEIICD
1631|gene|hwa       TTETTN---TALAATAVGKTVSQQYIQPTTGAELVDGIQSITSIPTEQISVLTALEVVCG
                         *     *:** :*.:**.**: *.*** **:*:*: : :. *::: *****::*.

21560|gene|hbo      TPDMHGTYLGNRERAAMYRFASTHAAEFTTDLGAAENFEEWLCAVKLARIFADWTAGESV
1631|gene|hwa       TPDMHDTYLGNRERADLYRFATSNMDTFVTNLSEIDDFESWLCTIKLAQILTAWSNGVTI
                    *****.********* :****:::   *.*:*.  ::**.***::***.*:: *: * ::

21560|gene|hbo      EAIVENYRIGPGDLEARLERVEWLLGAADAIADVVNADLPVFREVRDRL
1631|gene|hwa       DEIVERYRVGPGDIESHVERARWLLGTADALTETLGVEVDIFAEGHTQL
                    : ***.**:****:*:.:**. ****:***:::.:..:: :* * . .*