HOG Organism Gene ID Name Annotation
aHOG2855 hbo HBOR21580 Hbor_21580 hypothetical protein
aHOG2855 hwa HQ1630 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


21580|hp|hbo      MSSL--PHTSPRLVVGVGSLLLAFVATYVTVTAPGFPGN--LLSWPRALAGRLRRDLPRG
1630|hp|hwa       MITFQSQHVSLRAIIGVGSFLLSVIALQITRQTSGYPTHTRVHSWPRLLITQFRRDINKS
                  * ::   *.* * ::****:**:.:*  :*  :.*:* :  : **** *  .:***: ..

21580|hp|hbo      DRATAAWCGVALWSVLVTGLHFGGLHYRVYTTRPWWDLLTHAMGGVGVAAILAMTHRRSV
1630|hp|hwa       GSLRYGWVIIGLWSISVSGLHFGGLYYDIYTTVSWWDLLTHSLSGFGVAAVLGLTFRSST
                  .    .*  :.***: *:*******:* :*** .*******::.*.****:*.:*.* *.

21580|hp|hbo      AAGQSTWWLIPAVLAIGSGFEVYEFVFKTFWYNWTLRFYVVDTIIDLIINTSGAVVVAVA
1630|hp|hwa       T--PIPYWVIPAVLAIGSGFEVYEFVFKTFWYDWTFRFYLIDTVVDLVVNTAGAATFVIA
                  :    .:*:***********************:**:***::**::**::**:**....:*

21580|hp|hbo      LAGYRSLTGVT-AADDATAGTEFPK----
1630|hp|hwa       VGFLRETSMLQDSTDDASVTPELSSRRDS
                  :.  *. : :  ::***:. .*:..